Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DGX2

Protein Details
Accession A0A2H3DGX2    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
152-171SAEKERLRAEQEKKKKTKSSBasic
NLS Segment(s)
PositionSequence
158-170LRAEQEKKKKTKS
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023139  PBDC1-like_dom_sf  
IPR008476  PBDC1_metazoa/fungi  
Pfam View protein in Pfam  
PF04669  Polysacc_synt_4  
Amino Acid Sequences MAGKFDPQNAQNLVEIEKQFAVKAVEQAQVYWNLLEKIPPRQLRLTKLDDEIFEHTLKVFPEMTSEPYDKLIKLDEDWMKSKEGKERWRAFIQTYEKKIKDYNFGSLIRTDAREEYGEKNTIFVTRIQFYAIEISRNRLGLNDAAHEVAKVSAEKERLRAEQEKKKKTKSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.24
4 0.23
5 0.22
6 0.19
7 0.2
8 0.2
9 0.16
10 0.19
11 0.2
12 0.23
13 0.23
14 0.23
15 0.23
16 0.23
17 0.22
18 0.18
19 0.17
20 0.14
21 0.14
22 0.17
23 0.17
24 0.23
25 0.3
26 0.33
27 0.35
28 0.42
29 0.47
30 0.5
31 0.54
32 0.52
33 0.47
34 0.47
35 0.45
36 0.37
37 0.35
38 0.32
39 0.27
40 0.22
41 0.19
42 0.15
43 0.15
44 0.15
45 0.14
46 0.11
47 0.09
48 0.12
49 0.13
50 0.16
51 0.18
52 0.19
53 0.17
54 0.19
55 0.2
56 0.17
57 0.16
58 0.15
59 0.12
60 0.12
61 0.17
62 0.18
63 0.2
64 0.22
65 0.23
66 0.23
67 0.24
68 0.25
69 0.26
70 0.29
71 0.33
72 0.41
73 0.44
74 0.48
75 0.5
76 0.49
77 0.43
78 0.45
79 0.46
80 0.43
81 0.44
82 0.46
83 0.43
84 0.43
85 0.45
86 0.39
87 0.39
88 0.34
89 0.33
90 0.3
91 0.31
92 0.3
93 0.27
94 0.27
95 0.21
96 0.2
97 0.16
98 0.12
99 0.13
100 0.13
101 0.15
102 0.17
103 0.2
104 0.22
105 0.2
106 0.2
107 0.19
108 0.19
109 0.18
110 0.17
111 0.17
112 0.16
113 0.16
114 0.17
115 0.16
116 0.16
117 0.21
118 0.19
119 0.2
120 0.19
121 0.23
122 0.24
123 0.24
124 0.24
125 0.18
126 0.2
127 0.18
128 0.19
129 0.17
130 0.17
131 0.17
132 0.17
133 0.16
134 0.15
135 0.12
136 0.12
137 0.1
138 0.1
139 0.13
140 0.19
141 0.2
142 0.25
143 0.3
144 0.32
145 0.38
146 0.45
147 0.51
148 0.56
149 0.65
150 0.71
151 0.75