Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JZX5

Protein Details
Accession B6JZX5    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
248-273FTPPYPSCKKERFKKNCMVRGRNEPCHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 19, cyto_nucl 14.333, nucl 5.5, mito_nucl 3.832
Family & Domain DBs
InterPro View protein in InterPro  
IPR018228  DNase_TatD-rel_CS  
IPR032466  Metal_Hydrolase  
IPR001130  TatD-like  
Gene Ontology GO:0008296  F:3'-5'-DNA exonuclease activity  
Pfam View protein in Pfam  
PF01026  TatD_DNase  
PROSITE View protein in PROSITE  
PS01090  TATD_2  
PS01091  TATD_3  
CDD cd01310  TatD_DNAse  
Amino Acid Sequences LSYSLKLYDIGFNGTDPVFRGIYHDKQRHEDDFGAIIERAKSQGVERMMLTGDTLEHSEHALELCEKYDGLFACTAGVHPCQAEVFDKYPEGSEVYLEQLESFIRQNMAKGKIVAFGEIGLDYDRLHYANKETQLKCFEAQLGIATKVKLPLFLHSRAAADDFVSILSRYLPDLPKGGVVHSFTGSLEELDMYLKLGLYIGVNGCSLKTETNVEAVRRIPLDRLLLETDAPWCEVRPSHEGYKFLKDFTPPYPSCKKERFKKNCMVRGRNEPCNMVIVAKIVAEIKNISVEELCETVWKNSVSLLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.15
4 0.17
5 0.14
6 0.14
7 0.19
8 0.24
9 0.33
10 0.43
11 0.47
12 0.48
13 0.54
14 0.6
15 0.58
16 0.56
17 0.49
18 0.41
19 0.37
20 0.34
21 0.3
22 0.24
23 0.22
24 0.18
25 0.17
26 0.15
27 0.13
28 0.13
29 0.12
30 0.18
31 0.19
32 0.2
33 0.19
34 0.2
35 0.2
36 0.19
37 0.17
38 0.11
39 0.09
40 0.09
41 0.09
42 0.08
43 0.08
44 0.08
45 0.08
46 0.08
47 0.08
48 0.09
49 0.09
50 0.09
51 0.1
52 0.1
53 0.09
54 0.09
55 0.13
56 0.11
57 0.12
58 0.12
59 0.11
60 0.11
61 0.12
62 0.12
63 0.11
64 0.11
65 0.09
66 0.09
67 0.09
68 0.08
69 0.1
70 0.11
71 0.12
72 0.14
73 0.14
74 0.15
75 0.15
76 0.15
77 0.15
78 0.14
79 0.11
80 0.09
81 0.09
82 0.1
83 0.1
84 0.09
85 0.08
86 0.08
87 0.08
88 0.08
89 0.08
90 0.07
91 0.09
92 0.09
93 0.12
94 0.17
95 0.21
96 0.21
97 0.21
98 0.21
99 0.23
100 0.23
101 0.22
102 0.15
103 0.12
104 0.11
105 0.1
106 0.09
107 0.06
108 0.06
109 0.05
110 0.06
111 0.06
112 0.06
113 0.07
114 0.07
115 0.1
116 0.14
117 0.2
118 0.28
119 0.28
120 0.31
121 0.34
122 0.35
123 0.32
124 0.28
125 0.24
126 0.15
127 0.15
128 0.13
129 0.11
130 0.11
131 0.11
132 0.11
133 0.1
134 0.13
135 0.13
136 0.13
137 0.12
138 0.16
139 0.19
140 0.21
141 0.22
142 0.2
143 0.2
144 0.18
145 0.19
146 0.14
147 0.1
148 0.08
149 0.07
150 0.06
151 0.06
152 0.05
153 0.05
154 0.05
155 0.05
156 0.05
157 0.09
158 0.1
159 0.1
160 0.11
161 0.12
162 0.14
163 0.14
164 0.14
165 0.13
166 0.13
167 0.14
168 0.13
169 0.13
170 0.1
171 0.11
172 0.11
173 0.08
174 0.07
175 0.06
176 0.06
177 0.06
178 0.06
179 0.05
180 0.05
181 0.04
182 0.04
183 0.04
184 0.04
185 0.04
186 0.05
187 0.05
188 0.06
189 0.06
190 0.07
191 0.06
192 0.07
193 0.08
194 0.07
195 0.08
196 0.1
197 0.11
198 0.16
199 0.19
200 0.18
201 0.2
202 0.2
203 0.21
204 0.19
205 0.2
206 0.16
207 0.17
208 0.19
209 0.17
210 0.19
211 0.19
212 0.18
213 0.18
214 0.17
215 0.16
216 0.14
217 0.14
218 0.12
219 0.1
220 0.11
221 0.12
222 0.16
223 0.19
224 0.24
225 0.3
226 0.33
227 0.37
228 0.39
229 0.47
230 0.44
231 0.41
232 0.38
233 0.33
234 0.33
235 0.33
236 0.39
237 0.3
238 0.37
239 0.44
240 0.46
241 0.51
242 0.58
243 0.64
244 0.64
245 0.75
246 0.77
247 0.78
248 0.84
249 0.87
250 0.86
251 0.86
252 0.84
253 0.8
254 0.81
255 0.79
256 0.78
257 0.7
258 0.64
259 0.54
260 0.49
261 0.43
262 0.32
263 0.25
264 0.18
265 0.15
266 0.13
267 0.13
268 0.12
269 0.12
270 0.12
271 0.13
272 0.12
273 0.15
274 0.15
275 0.15
276 0.14
277 0.14
278 0.15
279 0.15
280 0.14
281 0.13
282 0.15
283 0.16
284 0.2
285 0.2
286 0.18