Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JWZ6

Protein Details
Accession B6JWZ6    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MKFSRDVTSSRRKQRKAHFAAPSSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, nucl 6.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041988  KOW_RPL26/RPL24  
IPR014722  Rib_L2_dom2  
IPR005825  Ribosomal_L24/26_CS  
IPR005756  Ribosomal_L26/L24P_euk/arc  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
GO:0042273  P:ribosomal large subunit biogenesis  
Pfam View protein in Pfam  
PF00467  KOW  
PF16906  Ribosomal_L26  
PROSITE View protein in PROSITE  
PS01108  RIBOSOMAL_L24  
CDD cd06089  KOW_RPL26  
Amino Acid Sequences MKFSRDVTSSRRKQRKAHFAAPSSVRRTLMSAPLSKELREQYKIRSLPIRREDQVTIVRGSNKGREGKVSSVYRKKWILQIERVTREKANGATVPVGVDASKVVISKLHLDKDRKALIVRKGGKVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.85
3 0.83
4 0.83
5 0.81
6 0.75
7 0.76
8 0.73
9 0.7
10 0.63
11 0.56
12 0.48
13 0.39
14 0.38
15 0.34
16 0.33
17 0.31
18 0.3
19 0.3
20 0.35
21 0.35
22 0.33
23 0.34
24 0.32
25 0.33
26 0.34
27 0.33
28 0.31
29 0.4
30 0.4
31 0.39
32 0.42
33 0.4
34 0.45
35 0.49
36 0.5
37 0.42
38 0.45
39 0.43
40 0.39
41 0.4
42 0.32
43 0.27
44 0.23
45 0.23
46 0.21
47 0.22
48 0.2
49 0.2
50 0.21
51 0.2
52 0.22
53 0.24
54 0.24
55 0.31
56 0.32
57 0.35
58 0.4
59 0.41
60 0.43
61 0.43
62 0.42
63 0.4
64 0.43
65 0.43
66 0.43
67 0.5
68 0.52
69 0.57
70 0.57
71 0.54
72 0.47
73 0.42
74 0.37
75 0.29
76 0.26
77 0.2
78 0.2
79 0.18
80 0.17
81 0.16
82 0.14
83 0.13
84 0.08
85 0.07
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.08
92 0.1
93 0.17
94 0.22
95 0.28
96 0.35
97 0.39
98 0.44
99 0.51
100 0.54
101 0.49
102 0.49
103 0.49
104 0.5
105 0.56
106 0.57