Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K7B8

Protein Details
Accession B6K7B8    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-30NIPKTRKTFCPGKQCRKHTVHRVTQYKKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKTRKTFCPGKQCRKHTVHRVTQYKKGADSKVAQGKRRYDRKQSGFGGQTKPVFHKKAKVTKKVVLRLECVVCKYKNQLTLKRCKHFELGGEKKTKGAAIQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.8
3 0.81
4 0.84
5 0.82
6 0.83
7 0.83
8 0.82
9 0.8
10 0.8
11 0.84
12 0.79
13 0.79
14 0.77
15 0.68
16 0.63
17 0.59
18 0.5
19 0.45
20 0.43
21 0.42
22 0.45
23 0.47
24 0.47
25 0.47
26 0.54
27 0.58
28 0.65
29 0.63
30 0.64
31 0.69
32 0.69
33 0.71
34 0.65
35 0.62
36 0.57
37 0.55
38 0.48
39 0.41
40 0.37
41 0.3
42 0.31
43 0.31
44 0.3
45 0.27
46 0.32
47 0.37
48 0.45
49 0.53
50 0.59
51 0.59
52 0.61
53 0.68
54 0.69
55 0.67
56 0.6
57 0.54
58 0.5
59 0.47
60 0.43
61 0.37
62 0.35
63 0.29
64 0.28
65 0.31
66 0.31
67 0.36
68 0.42
69 0.48
70 0.51
71 0.62
72 0.69
73 0.71
74 0.7
75 0.65
76 0.63
77 0.57
78 0.56
79 0.56
80 0.55
81 0.55
82 0.57
83 0.54
84 0.5
85 0.48
86 0.42