Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K2S1

Protein Details
Accession B6K2S1    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-78NTQSKAIKKQSSKKKNKTKLKQAMQAEHydrophilic
84-105LETKIQKALKHREKIKARKVAEHydrophilic
NLS Segment(s)
PositionSequence
57-104AIKKQSSKKKNKTKLKQAMQAEAREERLETKIQKALKHREKIKARKVA
Subcellular Location(s) nucl 18, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR022784  Ribosome_bgen_Alb1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF09135  Alb1  
Amino Acid Sequences MAKKQSLRSRNARRAVEPELQQDVPAKESNDSTDVRVAKELASVAARYNTTNTQSKAIKKQSSKKKNKTKLKQAMQAEAREERLETKIQKALKHREKIKARKVAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.67
3 0.63
4 0.56
5 0.5
6 0.47
7 0.42
8 0.38
9 0.37
10 0.31
11 0.27
12 0.25
13 0.22
14 0.17
15 0.18
16 0.2
17 0.19
18 0.19
19 0.17
20 0.2
21 0.2
22 0.19
23 0.2
24 0.18
25 0.15
26 0.15
27 0.13
28 0.09
29 0.09
30 0.08
31 0.08
32 0.1
33 0.1
34 0.09
35 0.11
36 0.12
37 0.14
38 0.18
39 0.19
40 0.21
41 0.24
42 0.28
43 0.34
44 0.4
45 0.43
46 0.46
47 0.54
48 0.61
49 0.69
50 0.76
51 0.79
52 0.82
53 0.86
54 0.91
55 0.92
56 0.92
57 0.91
58 0.89
59 0.87
60 0.8
61 0.78
62 0.72
63 0.64
64 0.56
65 0.48
66 0.41
67 0.33
68 0.29
69 0.22
70 0.2
71 0.23
72 0.22
73 0.24
74 0.28
75 0.3
76 0.36
77 0.42
78 0.51
79 0.56
80 0.63
81 0.66
82 0.71
83 0.79
84 0.84
85 0.85