Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JYB9

Protein Details
Accession B6JYB9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-25VKIVKKHTTQFKRHQSDNFKRVHydrophilic
NLS Segment(s)
PositionSequence
41-41R
Subcellular Location(s) mito 16, mito_nucl 13, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAAVKIVKKHTTQFKRHQSDNFKRVSESWRKPKGIDGVVRRRFRGTIRMPKIGYGSNKKTKYCMPNGLKAFLVRNVADVELLLMQNRPSLPRLPPTCLLASVSRSLRRPVPWVLRSPTLVLRSALKSKCKHSHLFLFKKFQCTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.79
4 0.8
5 0.8
6 0.81
7 0.79
8 0.75
9 0.65
10 0.59
11 0.56
12 0.56
13 0.56
14 0.55
15 0.58
16 0.61
17 0.61
18 0.6
19 0.63
20 0.62
21 0.58
22 0.56
23 0.55
24 0.57
25 0.64
26 0.66
27 0.61
28 0.55
29 0.5
30 0.45
31 0.45
32 0.43
33 0.45
34 0.49
35 0.54
36 0.52
37 0.51
38 0.51
39 0.46
40 0.42
41 0.4
42 0.42
43 0.44
44 0.48
45 0.47
46 0.47
47 0.49
48 0.5
49 0.48
50 0.5
51 0.45
52 0.49
53 0.5
54 0.49
55 0.43
56 0.37
57 0.32
58 0.23
59 0.22
60 0.13
61 0.13
62 0.12
63 0.11
64 0.1
65 0.09
66 0.07
67 0.06
68 0.06
69 0.05
70 0.05
71 0.05
72 0.07
73 0.07
74 0.08
75 0.09
76 0.12
77 0.14
78 0.22
79 0.25
80 0.29
81 0.3
82 0.32
83 0.31
84 0.29
85 0.29
86 0.23
87 0.22
88 0.22
89 0.24
90 0.25
91 0.26
92 0.28
93 0.3
94 0.3
95 0.33
96 0.36
97 0.42
98 0.42
99 0.47
100 0.49
101 0.48
102 0.47
103 0.46
104 0.43
105 0.36
106 0.34
107 0.28
108 0.28
109 0.29
110 0.36
111 0.38
112 0.4
113 0.42
114 0.5
115 0.58
116 0.6
117 0.62
118 0.61
119 0.67
120 0.7
121 0.75
122 0.74
123 0.75
124 0.73