Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3CEU0

Protein Details
Accession A0A2H3CEU0    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
23-42KYQIRYSGRRPLKRRRSQGSHydrophilic
NLS Segment(s)
PositionSequence
35-36KR
Subcellular Location(s) mito 11, nucl 8.5, cyto_nucl 8.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MVRRRILFHTVTLERVIYEESTKYQIRYSGRRPLKRRRSQGSEFETPLALTPRRSINPSFHGSIISMLSVGAVVYYVA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.2
4 0.12
5 0.12
6 0.11
7 0.12
8 0.17
9 0.18
10 0.18
11 0.18
12 0.22
13 0.25
14 0.31
15 0.35
16 0.4
17 0.48
18 0.56
19 0.63
20 0.69
21 0.75
22 0.77
23 0.81
24 0.79
25 0.78
26 0.75
27 0.76
28 0.72
29 0.66
30 0.57
31 0.49
32 0.41
33 0.32
34 0.28
35 0.22
36 0.16
37 0.12
38 0.14
39 0.18
40 0.2
41 0.23
42 0.25
43 0.27
44 0.33
45 0.37
46 0.36
47 0.32
48 0.31
49 0.28
50 0.27
51 0.21
52 0.15
53 0.1
54 0.08
55 0.07
56 0.06
57 0.05
58 0.04