Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DDR9

Protein Details
Accession A0A2H3DDR9   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
24-51HPNPSVLRQRGKRKNRRRNCNRSTKFLVHydrophilic
NLS Segment(s)
PositionSequence
31-41RQRGKRKNRRR
Subcellular Location(s) mito 14, extr 5, nucl 3.5, cyto_nucl 3.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MSRVTILRSAVSACIDALLQVRGHPNPSVLRQRGKRKNRRRNCNRSTKFLVSNQIPSTRKVVFFHIQWLVVGAGRRGNRKGRGIFFIRGQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.09
4 0.1
5 0.1
6 0.08
7 0.09
8 0.13
9 0.14
10 0.16
11 0.16
12 0.17
13 0.19
14 0.25
15 0.33
16 0.33
17 0.41
18 0.47
19 0.57
20 0.65
21 0.73
22 0.78
23 0.8
24 0.87
25 0.89
26 0.92
27 0.93
28 0.93
29 0.92
30 0.92
31 0.84
32 0.81
33 0.78
34 0.71
35 0.64
36 0.56
37 0.53
38 0.43
39 0.44
40 0.38
41 0.38
42 0.35
43 0.32
44 0.33
45 0.29
46 0.29
47 0.26
48 0.3
49 0.26
50 0.26
51 0.3
52 0.28
53 0.26
54 0.24
55 0.24
56 0.18
57 0.16
58 0.16
59 0.12
60 0.15
61 0.18
62 0.23
63 0.27
64 0.34
65 0.39
66 0.47
67 0.54
68 0.53
69 0.58
70 0.59