Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3EIY6

Protein Details
Accession A0A2H3EIY6   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
41-69SPTSNIKTKAPSKSPKKRRTNTGKAKAIPHydrophilic
NLS Segment(s)
PositionSequence
27-66KNKEAKPGKRKASSSPTSNIKTKAPSKSPKKRRTNTGKAK
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MDSDDELPHWSVLIGRKTGGSGTDGLKNKEAKPGKRKASSSPTSNIKTKAPSKSPKKRRTNTGKAKAIPAVSEIIEISSDDEQVNCPTAVRSRNRNTKSPFNIKAEKRPEIVTRSPESNNTPAHRTRAHATTPAARPSKSYFGRLCTGQKLDFVPRTPVESVNMVSGKEGDEDARSMTLDTPTDSEAPVNLSRTYFERICKWVGHDVDFNVGRVNLRGSNTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.23
5 0.24
6 0.22
7 0.17
8 0.15
9 0.16
10 0.24
11 0.27
12 0.29
13 0.33
14 0.36
15 0.35
16 0.42
17 0.47
18 0.49
19 0.55
20 0.62
21 0.66
22 0.71
23 0.72
24 0.72
25 0.74
26 0.72
27 0.67
28 0.65
29 0.63
30 0.6
31 0.62
32 0.55
33 0.49
34 0.49
35 0.5
36 0.52
37 0.52
38 0.58
39 0.64
40 0.72
41 0.8
42 0.83
43 0.87
44 0.87
45 0.89
46 0.89
47 0.9
48 0.9
49 0.89
50 0.87
51 0.78
52 0.74
53 0.66
54 0.55
55 0.44
56 0.35
57 0.25
58 0.17
59 0.15
60 0.12
61 0.09
62 0.08
63 0.08
64 0.08
65 0.06
66 0.07
67 0.07
68 0.07
69 0.08
70 0.08
71 0.1
72 0.08
73 0.08
74 0.08
75 0.12
76 0.18
77 0.22
78 0.3
79 0.37
80 0.47
81 0.51
82 0.58
83 0.59
84 0.63
85 0.66
86 0.66
87 0.63
88 0.59
89 0.64
90 0.58
91 0.62
92 0.58
93 0.53
94 0.46
95 0.42
96 0.39
97 0.37
98 0.37
99 0.33
100 0.29
101 0.3
102 0.29
103 0.29
104 0.29
105 0.28
106 0.29
107 0.26
108 0.28
109 0.26
110 0.29
111 0.28
112 0.27
113 0.26
114 0.27
115 0.26
116 0.26
117 0.26
118 0.3
119 0.32
120 0.36
121 0.35
122 0.31
123 0.31
124 0.32
125 0.39
126 0.33
127 0.36
128 0.31
129 0.33
130 0.36
131 0.37
132 0.36
133 0.32
134 0.33
135 0.27
136 0.27
137 0.26
138 0.29
139 0.29
140 0.27
141 0.28
142 0.25
143 0.29
144 0.28
145 0.26
146 0.23
147 0.22
148 0.21
149 0.2
150 0.2
151 0.16
152 0.15
153 0.15
154 0.13
155 0.12
156 0.12
157 0.08
158 0.09
159 0.09
160 0.1
161 0.1
162 0.09
163 0.09
164 0.1
165 0.12
166 0.11
167 0.12
168 0.12
169 0.14
170 0.14
171 0.14
172 0.13
173 0.11
174 0.15
175 0.16
176 0.17
177 0.16
178 0.16
179 0.17
180 0.2
181 0.26
182 0.24
183 0.26
184 0.29
185 0.32
186 0.34
187 0.35
188 0.36
189 0.38
190 0.39
191 0.39
192 0.37
193 0.35
194 0.4
195 0.38
196 0.34
197 0.28
198 0.26
199 0.23
200 0.2
201 0.23
202 0.19