Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K4P1

Protein Details
Accession B6K4P1    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPKAARKTRRKDPNAPKRNMSAHydrophilic
NLS Segment(s)
PositionSequence
5-15ARKTRRKDPNA
92-93KK
97-106SPPKAPSPKA
Subcellular Location(s) mito 14, nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0000785  C:chromatin  
GO:0030875  C:rDNA protrusion  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAARKTRRKDPNAPKRNMSAFMFFSMSNREKIKEENPEATFGQIGSLLGKKWKTLTAVEKEPYEEKARKDKERYERECMKGPAKTGEPVKKETNSPPKAPSPKAPSPKAPSPTVPSNESEKNAETDSTKAEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.81
4 0.77
5 0.73
6 0.67
7 0.58
8 0.52
9 0.43
10 0.39
11 0.36
12 0.28
13 0.25
14 0.27
15 0.26
16 0.25
17 0.25
18 0.24
19 0.24
20 0.29
21 0.34
22 0.36
23 0.38
24 0.42
25 0.41
26 0.42
27 0.41
28 0.37
29 0.31
30 0.21
31 0.17
32 0.1
33 0.09
34 0.07
35 0.07
36 0.07
37 0.1
38 0.11
39 0.11
40 0.12
41 0.14
42 0.15
43 0.18
44 0.25
45 0.27
46 0.32
47 0.33
48 0.32
49 0.32
50 0.3
51 0.29
52 0.27
53 0.24
54 0.22
55 0.3
56 0.35
57 0.4
58 0.43
59 0.49
60 0.54
61 0.62
62 0.65
63 0.64
64 0.66
65 0.64
66 0.65
67 0.61
68 0.55
69 0.46
70 0.42
71 0.37
72 0.32
73 0.32
74 0.33
75 0.37
76 0.35
77 0.38
78 0.41
79 0.39
80 0.41
81 0.46
82 0.5
83 0.48
84 0.48
85 0.48
86 0.53
87 0.57
88 0.58
89 0.57
90 0.55
91 0.59
92 0.65
93 0.65
94 0.64
95 0.65
96 0.7
97 0.67
98 0.62
99 0.57
100 0.55
101 0.58
102 0.54
103 0.49
104 0.44
105 0.45
106 0.46
107 0.44
108 0.4
109 0.34
110 0.33
111 0.31
112 0.3
113 0.25
114 0.23