Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3E3M1

Protein Details
Accession A0A2H3E3M1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
7-35PPPSSGGKAAKKKKWSKGKVKDKAQHAVSHydrophilic
NLS Segment(s)
PositionSequence
4-29AKAPPPSSGGKAAKKKKWSKGKVKDK
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAKAKAPPPSSGGKAAKKKKWSKGKVKDKAQHAVSLDKATYDRIIKEVPTFRFISQSILIERLKINGSLARIAIRHLEKDGQIKRIVHHSSQLVYTRSTTASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.68
4 0.72
5 0.78
6 0.79
7 0.82
8 0.83
9 0.85
10 0.86
11 0.9
12 0.9
13 0.91
14 0.88
15 0.84
16 0.82
17 0.72
18 0.65
19 0.56
20 0.49
21 0.4
22 0.34
23 0.28
24 0.2
25 0.18
26 0.15
27 0.15
28 0.13
29 0.12
30 0.12
31 0.12
32 0.12
33 0.16
34 0.21
35 0.2
36 0.22
37 0.23
38 0.22
39 0.24
40 0.23
41 0.22
42 0.18
43 0.18
44 0.15
45 0.17
46 0.17
47 0.16
48 0.15
49 0.14
50 0.14
51 0.12
52 0.12
53 0.11
54 0.12
55 0.12
56 0.13
57 0.13
58 0.12
59 0.13
60 0.17
61 0.17
62 0.17
63 0.18
64 0.2
65 0.21
66 0.3
67 0.33
68 0.32
69 0.35
70 0.35
71 0.35
72 0.41
73 0.43
74 0.36
75 0.37
76 0.36
77 0.33
78 0.37
79 0.4
80 0.33
81 0.3
82 0.3
83 0.27