Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3D7Q4

Protein Details
Accession A0A2H3D7Q4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23RIRRQLAQKKGRNQKGKSHRMPGBasic
NLS Segment(s)
PositionSequence
9-17KKGRNQKGK
Subcellular Location(s) nucl 12.5, mito 9, cyto_nucl 9, cyto 4.5
Family & Domain DBs
Amino Acid Sequences RIRRQLAQKKGRNQKGKSHRMPGGDGMPQLLTGNDFYTKVVQYEESVSRKEAEKETWHVNKESQVNALTKAMEQWKIADEEWQEQNKAKEDEWKEAVAKWEQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.84
4 0.82
5 0.8
6 0.74
7 0.68
8 0.66
9 0.59
10 0.52
11 0.43
12 0.35
13 0.28
14 0.23
15 0.19
16 0.16
17 0.12
18 0.09
19 0.07
20 0.08
21 0.08
22 0.08
23 0.08
24 0.1
25 0.1
26 0.1
27 0.1
28 0.09
29 0.1
30 0.13
31 0.17
32 0.17
33 0.17
34 0.18
35 0.18
36 0.19
37 0.21
38 0.19
39 0.17
40 0.18
41 0.21
42 0.28
43 0.31
44 0.31
45 0.3
46 0.3
47 0.32
48 0.31
49 0.29
50 0.24
51 0.22
52 0.21
53 0.21
54 0.21
55 0.17
56 0.14
57 0.16
58 0.17
59 0.16
60 0.16
61 0.15
62 0.16
63 0.18
64 0.18
65 0.19
66 0.18
67 0.21
68 0.27
69 0.29
70 0.28
71 0.29
72 0.33
73 0.35
74 0.36
75 0.31
76 0.34
77 0.36
78 0.42
79 0.42
80 0.42
81 0.37
82 0.37
83 0.41