Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JZW9

Protein Details
Accession B6JZW9    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-48ITTSKPPQTEEEKRQKKRRRRTTDAEARFLEHydrophilic
NLS Segment(s)
PositionSequence
30-38KRQKKRRRR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
IPR001356  Homeobox_dom  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0000122  P:negative regulation of transcription by RNA polymerase II  
GO:0071930  P:negative regulation of transcription involved in G1/S transition of mitotic cell cycle  
GO:0071931  P:positive regulation of transcription involved in G1/S transition of mitotic cell cycle  
Pfam View protein in Pfam  
PF00046  Homeodomain  
PROSITE View protein in PROSITE  
PS50071  HOMEOBOX_2  
CDD cd00086  homeodomain  
Amino Acid Sequences MAEKNTASPASSQEKDQITTSKPPQTEEEKRQKKRRRRTTDAEARFLEQYFLKTPKPTLAERQQLSREMNFCMTPRELQIWFQNKRQSLRRSNSLARSKSEVSASLQRLHHRPSLALCETQNGQAEVFFQIGQSPSVTRPNTVAGGDVPAGGSMTGRLERKPDVPAATAARSLSTPISQMKKRSPVTPKDLEECARSLVQLQQR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.36
4 0.35
5 0.32
6 0.39
7 0.43
8 0.43
9 0.42
10 0.42
11 0.45
12 0.5
13 0.55
14 0.57
15 0.62
16 0.66
17 0.75
18 0.83
19 0.88
20 0.89
21 0.91
22 0.92
23 0.91
24 0.9
25 0.89
26 0.89
27 0.9
28 0.86
29 0.82
30 0.72
31 0.64
32 0.55
33 0.46
34 0.37
35 0.26
36 0.22
37 0.2
38 0.21
39 0.21
40 0.21
41 0.22
42 0.26
43 0.29
44 0.29
45 0.33
46 0.39
47 0.45
48 0.45
49 0.5
50 0.47
51 0.48
52 0.47
53 0.42
54 0.34
55 0.27
56 0.28
57 0.23
58 0.21
59 0.2
60 0.19
61 0.16
62 0.16
63 0.18
64 0.16
65 0.18
66 0.25
67 0.3
68 0.32
69 0.35
70 0.39
71 0.39
72 0.43
73 0.49
74 0.5
75 0.51
76 0.53
77 0.56
78 0.57
79 0.59
80 0.63
81 0.63
82 0.57
83 0.5
84 0.49
85 0.43
86 0.38
87 0.33
88 0.25
89 0.2
90 0.25
91 0.24
92 0.25
93 0.26
94 0.27
95 0.29
96 0.31
97 0.31
98 0.24
99 0.23
100 0.2
101 0.25
102 0.24
103 0.23
104 0.2
105 0.19
106 0.2
107 0.21
108 0.2
109 0.14
110 0.12
111 0.11
112 0.12
113 0.1
114 0.1
115 0.08
116 0.06
117 0.07
118 0.08
119 0.08
120 0.08
121 0.08
122 0.09
123 0.17
124 0.17
125 0.17
126 0.17
127 0.19
128 0.2
129 0.19
130 0.18
131 0.11
132 0.13
133 0.12
134 0.11
135 0.09
136 0.07
137 0.07
138 0.06
139 0.05
140 0.04
141 0.06
142 0.1
143 0.11
144 0.12
145 0.15
146 0.18
147 0.2
148 0.23
149 0.25
150 0.24
151 0.25
152 0.28
153 0.29
154 0.28
155 0.28
156 0.25
157 0.21
158 0.19
159 0.18
160 0.16
161 0.13
162 0.14
163 0.19
164 0.26
165 0.3
166 0.36
167 0.43
168 0.51
169 0.53
170 0.59
171 0.62
172 0.64
173 0.68
174 0.7
175 0.67
176 0.62
177 0.64
178 0.59
179 0.52
180 0.45
181 0.4
182 0.31
183 0.27
184 0.24