Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DHM3

Protein Details
Accession A0A2H3DHM3    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MKACPKVFHKKVGNPPHRKWSLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR032567  LDOC1-rel  
Amino Acid Sequences MKACPKVFHKKVGNPPHRKWSLNIETADNPPVKICGHPHSPPEHEAICKFIDEGLEDGIIEPSDSSWSAPLILVPKKDGMLRVCVDFRALNRVTKRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.82
3 0.82
4 0.79
5 0.71
6 0.64
7 0.63
8 0.6
9 0.57
10 0.52
11 0.45
12 0.43
13 0.42
14 0.44
15 0.33
16 0.26
17 0.19
18 0.19
19 0.16
20 0.15
21 0.16
22 0.17
23 0.23
24 0.25
25 0.28
26 0.31
27 0.33
28 0.33
29 0.33
30 0.29
31 0.24
32 0.22
33 0.21
34 0.16
35 0.14
36 0.12
37 0.1
38 0.09
39 0.08
40 0.08
41 0.06
42 0.06
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.04
49 0.04
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.07
56 0.07
57 0.08
58 0.12
59 0.15
60 0.16
61 0.17
62 0.18
63 0.19
64 0.2
65 0.24
66 0.21
67 0.24
68 0.25
69 0.27
70 0.27
71 0.26
72 0.27
73 0.25
74 0.24
75 0.26
76 0.27
77 0.3