Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

T0S317

Protein Details
Accession T0S317   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
52-77EETHHWNEWKKKEKEKRTNELQRIAPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 9, mito 8
Family & Domain DBs
Amino Acid Sequences MNERNMQHSLFPSIPQLPSSLYLPPANLEQNIKRINCNLIHVQPRKYPSIEEETHHWNEWKKKEKEKRTNELQRIAPGYSESTPLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.22
4 0.18
5 0.19
6 0.19
7 0.16
8 0.16
9 0.16
10 0.16
11 0.16
12 0.16
13 0.16
14 0.16
15 0.18
16 0.17
17 0.23
18 0.28
19 0.27
20 0.26
21 0.26
22 0.29
23 0.26
24 0.28
25 0.24
26 0.25
27 0.33
28 0.35
29 0.36
30 0.36
31 0.37
32 0.36
33 0.33
34 0.29
35 0.24
36 0.28
37 0.26
38 0.25
39 0.26
40 0.3
41 0.31
42 0.31
43 0.3
44 0.28
45 0.34
46 0.42
47 0.48
48 0.49
49 0.57
50 0.67
51 0.76
52 0.82
53 0.84
54 0.84
55 0.85
56 0.89
57 0.86
58 0.83
59 0.75
60 0.71
61 0.64
62 0.55
63 0.45
64 0.35
65 0.32
66 0.25