Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6JX06

Protein Details
Accession B6JX06    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-39MPARNDRQKLRKSKSESIIHGRVPSKKTLKKQIRNGKYSHydrophilic
NLS Segment(s)
PositionSequence
9-37KLRKSKSESIIHGRVPSKKTLKKQIRNGK
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MPARNDRQKLRKSKSESIIHGRVPSKKTLKKQIRNGKYSLKRLAEKGVELDDLMTDVTPLNLDPALEKKLKNKNKASKLFASGADVKKDSDTAAMDVQSTGRGTILGAPAM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.78
4 0.76
5 0.73
6 0.65
7 0.62
8 0.57
9 0.54
10 0.48
11 0.49
12 0.5
13 0.51
14 0.57
15 0.62
16 0.69
17 0.72
18 0.8
19 0.83
20 0.83
21 0.8
22 0.76
23 0.76
24 0.73
25 0.7
26 0.67
27 0.61
28 0.54
29 0.51
30 0.52
31 0.43
32 0.35
33 0.3
34 0.24
35 0.18
36 0.16
37 0.14
38 0.08
39 0.07
40 0.06
41 0.05
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.04
48 0.04
49 0.04
50 0.04
51 0.07
52 0.11
53 0.13
54 0.14
55 0.21
56 0.31
57 0.39
58 0.47
59 0.55
60 0.61
61 0.7
62 0.77
63 0.76
64 0.71
65 0.68
66 0.62
67 0.53
68 0.48
69 0.45
70 0.4
71 0.37
72 0.32
73 0.28
74 0.26
75 0.25
76 0.2
77 0.16
78 0.15
79 0.14
80 0.15
81 0.15
82 0.14
83 0.14
84 0.14
85 0.14
86 0.12
87 0.1
88 0.08
89 0.08
90 0.08
91 0.12