Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K0W6

Protein Details
Accession B6K0W6   
Localization Confidence Low
Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
177-199RASMMKYKAPSRQKMKKKRCIVLHydrophilic
NLS Segment(s)
PositionSequence
188-194RQKMKKK
Subcellular Location(s) cyto 15.5, cyto_mito 11, mito 5.5, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR001806  Small_GTPase  
IPR003578  Small_GTPase_Rho  
Gene Ontology GO:0032153  C:cell division site  
GO:0051286  C:cell tip  
GO:0005737  C:cytoplasm  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0032995  P:regulation of fungal-type cell wall biogenesis  
GO:0007264  P:small GTPase mediated signal transduction  
Pfam View protein in Pfam  
PF00071  Ras  
PROSITE View protein in PROSITE  
PS51419  RAB  
PS51421  RAS  
PS51420  RHO  
CDD cd01870  RhoA_like  
Amino Acid Sequences MSTELRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVNVDGRHIELALWDTAGQEDYDRLRPLSYPDSHVILICFAVDAPESLDNVQEKWISEVLHFCSNLPIILVACKKDLRNDPKTIEELSKTNEKPISSEEGEAVAQKIGAFKYLECSAKQNDGVQEVFETAARASMMKYKAPSRQKMKKKRCIVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.27
3 0.24
4 0.19
5 0.16
6 0.13
7 0.12
8 0.09
9 0.09
10 0.1
11 0.12
12 0.15
13 0.15
14 0.17
15 0.17
16 0.18
17 0.16
18 0.16
19 0.19
20 0.18
21 0.2
22 0.18
23 0.19
24 0.18
25 0.2
26 0.18
27 0.13
28 0.11
29 0.1
30 0.11
31 0.1
32 0.08
33 0.07
34 0.09
35 0.09
36 0.09
37 0.07
38 0.06
39 0.07
40 0.06
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.07
48 0.07
49 0.08
50 0.07
51 0.05
52 0.07
53 0.09
54 0.12
55 0.13
56 0.13
57 0.13
58 0.13
59 0.17
60 0.22
61 0.21
62 0.22
63 0.23
64 0.25
65 0.25
66 0.24
67 0.2
68 0.14
69 0.13
70 0.08
71 0.06
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.06
79 0.06
80 0.07
81 0.07
82 0.08
83 0.09
84 0.08
85 0.08
86 0.09
87 0.1
88 0.09
89 0.09
90 0.11
91 0.13
92 0.15
93 0.15
94 0.14
95 0.13
96 0.13
97 0.13
98 0.1
99 0.08
100 0.05
101 0.09
102 0.1
103 0.09
104 0.11
105 0.13
106 0.14
107 0.19
108 0.28
109 0.33
110 0.38
111 0.42
112 0.43
113 0.44
114 0.46
115 0.42
116 0.36
117 0.3
118 0.25
119 0.24
120 0.29
121 0.26
122 0.28
123 0.29
124 0.27
125 0.26
126 0.27
127 0.31
128 0.24
129 0.24
130 0.21
131 0.2
132 0.2
133 0.19
134 0.16
135 0.09
136 0.08
137 0.08
138 0.09
139 0.08
140 0.1
141 0.1
142 0.09
143 0.14
144 0.19
145 0.21
146 0.2
147 0.24
148 0.25
149 0.29
150 0.31
151 0.3
152 0.27
153 0.28
154 0.28
155 0.24
156 0.22
157 0.18
158 0.17
159 0.13
160 0.12
161 0.08
162 0.09
163 0.09
164 0.09
165 0.09
166 0.15
167 0.18
168 0.2
169 0.25
170 0.29
171 0.38
172 0.48
173 0.57
174 0.6
175 0.69
176 0.76
177 0.83
178 0.88
179 0.9