Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DLT7

Protein Details
Accession A0A2H3DLT7   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
76-98ISPTKKDSLKRPKKPAALRPRPSHydrophilic
NLS Segment(s)
PositionSequence
81-98KDSLKRPKKPAALRPRPS
151-167KSPKKKGIPSPIAIFKR
187-201PRTPKPVTPRTPKLP
207-209PKP
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
Amino Acid Sequences MTPMTSQNKRPTAFAVVAAFVSASRTMLRTTASSIHATSPSPIPTIPDENDEHTLTGFGDISLSDDCFIPGIASDISPTKKDSLKRPKKPAALRPRPSVLSNRPPPPLMAKALRSPTEHQRLIKAALAEPKVNFKTLIDSVRLTEEKISQKSPKKKGIPSPIAIFKRGAASSPPPSPWAPVTSPRTPRTPKPVTPRTPKLPSSPQSPKPWRGNSPLPKRPPLPTWDLVYPELADDKEENTEEKHQDKSQQKKTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.34
3 0.27
4 0.25
5 0.23
6 0.19
7 0.13
8 0.13
9 0.09
10 0.08
11 0.08
12 0.09
13 0.1
14 0.11
15 0.13
16 0.13
17 0.16
18 0.19
19 0.21
20 0.22
21 0.23
22 0.24
23 0.24
24 0.23
25 0.22
26 0.21
27 0.2
28 0.19
29 0.18
30 0.18
31 0.2
32 0.25
33 0.24
34 0.25
35 0.25
36 0.28
37 0.31
38 0.29
39 0.25
40 0.2
41 0.19
42 0.15
43 0.14
44 0.1
45 0.07
46 0.06
47 0.06
48 0.07
49 0.08
50 0.08
51 0.07
52 0.07
53 0.07
54 0.07
55 0.07
56 0.05
57 0.05
58 0.06
59 0.06
60 0.06
61 0.07
62 0.1
63 0.12
64 0.13
65 0.14
66 0.15
67 0.2
68 0.24
69 0.34
70 0.42
71 0.52
72 0.61
73 0.69
74 0.75
75 0.79
76 0.83
77 0.83
78 0.83
79 0.83
80 0.79
81 0.74
82 0.7
83 0.63
84 0.57
85 0.54
86 0.5
87 0.49
88 0.5
89 0.49
90 0.47
91 0.45
92 0.44
93 0.4
94 0.36
95 0.3
96 0.26
97 0.24
98 0.27
99 0.3
100 0.31
101 0.3
102 0.3
103 0.34
104 0.39
105 0.39
106 0.35
107 0.34
108 0.33
109 0.32
110 0.31
111 0.23
112 0.17
113 0.19
114 0.2
115 0.19
116 0.18
117 0.21
118 0.2
119 0.2
120 0.18
121 0.13
122 0.16
123 0.17
124 0.19
125 0.15
126 0.15
127 0.15
128 0.19
129 0.19
130 0.15
131 0.14
132 0.17
133 0.21
134 0.23
135 0.25
136 0.29
137 0.38
138 0.47
139 0.53
140 0.57
141 0.59
142 0.64
143 0.69
144 0.73
145 0.71
146 0.65
147 0.63
148 0.62
149 0.57
150 0.52
151 0.43
152 0.33
153 0.3
154 0.26
155 0.22
156 0.16
157 0.19
158 0.22
159 0.25
160 0.25
161 0.24
162 0.24
163 0.26
164 0.24
165 0.24
166 0.22
167 0.28
168 0.34
169 0.38
170 0.45
171 0.46
172 0.52
173 0.53
174 0.56
175 0.58
176 0.59
177 0.59
178 0.62
179 0.7
180 0.71
181 0.76
182 0.78
183 0.77
184 0.76
185 0.72
186 0.69
187 0.69
188 0.64
189 0.63
190 0.64
191 0.63
192 0.67
193 0.72
194 0.73
195 0.73
196 0.76
197 0.73
198 0.71
199 0.74
200 0.74
201 0.77
202 0.77
203 0.75
204 0.74
205 0.72
206 0.69
207 0.64
208 0.6
209 0.57
210 0.52
211 0.5
212 0.47
213 0.47
214 0.43
215 0.39
216 0.32
217 0.25
218 0.24
219 0.18
220 0.16
221 0.14
222 0.14
223 0.16
224 0.17
225 0.17
226 0.19
227 0.26
228 0.29
229 0.31
230 0.35
231 0.35
232 0.44
233 0.52
234 0.59