FuNGI

B6K0V5

Protein Details

Accession

B6K0V5

Localization Confidence

Medium

Confidence Score

12.8

NoLS Segment(s)

Position	Sequence	Protein Nature
405-453	DEWCTLAQKTREKRRQKLRSAGGAKFKFRKARRALKRRARKLSFHQVHS	Hydrophilic

NLS Segment(s)

Position	Sequence
414-445	TREKRRQKLRSAGGAKFKFRKARRALKRRARK

Subcellular Location(s)

nucl 19, cyto_nucl 14, cyto 7

Family & Domain DBs

InterPro	View protein in InterPro IPR018837 TF_CRF1/IFH1
Gene Ontology	GO:0003712 F:transcription coregulator activity GO:0060962 P:regulation of ribosomal protein gene transcription by RNA polymerase II GO:0006357 P:regulation of transcription by RNA polymerase II
Pfam	View protein in Pfam PF10380 CRF1

Amino Acid Sequences

MASTCEMMQKPSPVEGDDGLINEKAVGEKLTAGVFLNENFVKYDGNNYSIDGSAVGTSMTPEKENNSSASSTTSEEPCAALATNGKPAYTASFNIQEMGKLSLAVENELPVQENDDETVIEGLPGTDDSPLLSEKGMIDAPFASSFLNDITDAIVALPDELDIDLLAFDTEQQENAIFYPHVNMDERLEDDFLMGFLSSEDEKESTGDEQDDVDLIGWECFFDSSGDEMTDYDLNDFSEATDDELPTFLPTKEVNEQRVSSQCVAEVHVKDSNDSEASDLPVLGVWALEMEEPNAIIDGSHTLHVHDDGSFEEVVPFPISESISYGSVDDTTEKEDTSVRETNLEEILDTSLIQSTSRSTISDSCTSVEHKEDKSLSRWDRIPIGTFRRNQYIRSMAIKEELVRDEWCTLAQKTREKRRQKLRSAGGAKFKFRKARRALKRRARKLSFHQVHSDFQSALEERDGLNDSFSKLEQNGFGLTPELSPLFETIGFSEI

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.3
2	0.27
3	0.26
4	0.22
5	0.21
6	0.19
7	0.17
8	0.16
9	0.13
10	0.13
11	0.11
12	0.11
13	0.11
14	0.09
15	0.1
16	0.11
17	0.12
18	0.12
19	0.11
20	0.12
21	0.13
22	0.12
23	0.17
24	0.16
25	0.16
26	0.17
27	0.17
28	0.16
29	0.15
30	0.23
31	0.2
32	0.23
33	0.23
34	0.22
35	0.23
36	0.22
37	0.22
38	0.15
39	0.13
40	0.1
41	0.09
42	0.08
43	0.06
44	0.07
45	0.1
46	0.11
47	0.12
48	0.13
49	0.16
50	0.2
51	0.22
52	0.23
53	0.24
54	0.23
55	0.23
56	0.25
57	0.23
58	0.21
59	0.23
60	0.22
61	0.2
62	0.19
63	0.19
64	0.16
65	0.15
66	0.13
67	0.1
68	0.13
69	0.14
70	0.2
71	0.2
72	0.2
73	0.19
74	0.2
75	0.23
76	0.21
77	0.21
78	0.18
79	0.22
80	0.23
81	0.24
82	0.24
83	0.2
84	0.19
85	0.2
86	0.16
87	0.11
88	0.12
89	0.12
90	0.12
91	0.13
92	0.12
93	0.1
94	0.1
95	0.1
96	0.11
97	0.09
98	0.11
99	0.1
100	0.11
101	0.11
102	0.1
103	0.1
104	0.09
105	0.1
106	0.07
107	0.06
108	0.06
109	0.05
110	0.05
111	0.05
112	0.05
113	0.05
114	0.05
115	0.05
116	0.06
117	0.07
118	0.07
119	0.07
120	0.08
121	0.07
122	0.1
123	0.11
124	0.09
125	0.09
126	0.09
127	0.11
128	0.1
129	0.1
130	0.08
131	0.07
132	0.07
133	0.07
134	0.08
135	0.06
136	0.06
137	0.06
138	0.06
139	0.06
140	0.06
141	0.05
142	0.04
143	0.04
144	0.04
145	0.03
146	0.04
147	0.03
148	0.03
149	0.03
150	0.03
151	0.03
152	0.03
153	0.03
154	0.03
155	0.03
156	0.05
157	0.06
158	0.06
159	0.06
160	0.07
161	0.07
162	0.07
163	0.09
164	0.07
165	0.07
166	0.09
167	0.09
168	0.1
169	0.11
170	0.12
171	0.12
172	0.13
173	0.14
174	0.13
175	0.13
176	0.11
177	0.1
178	0.09
179	0.07
180	0.06
181	0.05
182	0.04
183	0.04
184	0.05
185	0.05
186	0.05
187	0.06
188	0.06
189	0.06
190	0.07
191	0.08
192	0.07
193	0.08
194	0.08
195	0.07
196	0.07
197	0.07
198	0.07
199	0.06
200	0.05
201	0.05
202	0.05
203	0.05
204	0.04
205	0.04
206	0.04
207	0.04
208	0.04
209	0.04
210	0.05
211	0.05
212	0.06
213	0.06
214	0.06
215	0.07
216	0.07
217	0.08
218	0.07
219	0.07
220	0.07
221	0.07
222	0.07
223	0.06
224	0.05
225	0.05
226	0.05
227	0.07
228	0.07
229	0.07
230	0.07
231	0.07
232	0.07
233	0.07
234	0.08
235	0.06
236	0.07
237	0.07
238	0.1
239	0.17
240	0.2
241	0.23
242	0.24
243	0.25
244	0.25
245	0.28
246	0.28
247	0.23
248	0.19
249	0.17
250	0.15
251	0.17
252	0.19
253	0.17
254	0.16
255	0.18
256	0.18
257	0.17
258	0.17
259	0.16
260	0.12
261	0.11
262	0.1
263	0.08
264	0.09
265	0.09
266	0.08
267	0.06
268	0.06
269	0.06
270	0.04
271	0.04
272	0.03
273	0.02
274	0.03
275	0.03
276	0.03
277	0.04
278	0.04
279	0.04
280	0.04
281	0.04
282	0.04
283	0.03
284	0.04
285	0.05
286	0.06
287	0.07
288	0.07
289	0.08
290	0.08
291	0.09
292	0.09
293	0.08
294	0.07
295	0.06
296	0.09
297	0.08
298	0.08
299	0.08
300	0.08
301	0.08
302	0.08
303	0.08
304	0.06
305	0.08
306	0.08
307	0.07
308	0.09
309	0.09
310	0.09
311	0.1
312	0.09
313	0.08
314	0.08
315	0.09
316	0.08
317	0.08
318	0.1
319	0.1
320	0.1
321	0.1
322	0.12
323	0.13
324	0.18
325	0.21
326	0.18
327	0.2
328	0.21
329	0.22
330	0.21
331	0.2
332	0.14
333	0.11
334	0.11
335	0.09
336	0.09
337	0.07
338	0.07
339	0.07
340	0.07
341	0.07
342	0.08
343	0.1
344	0.11
345	0.11
346	0.12
347	0.15
348	0.2
349	0.24
350	0.23
351	0.21
352	0.23
353	0.24
354	0.24
355	0.25
356	0.25
357	0.22
358	0.27
359	0.29
360	0.31
361	0.33
362	0.41
363	0.39
364	0.41
365	0.43
366	0.4
367	0.43
368	0.41
369	0.42
370	0.4
371	0.45
372	0.46
373	0.48
374	0.49
375	0.53
376	0.53
377	0.49
378	0.49
379	0.46
380	0.43
381	0.44
382	0.42
383	0.34
384	0.35
385	0.35
386	0.3
387	0.28
388	0.26
389	0.22
390	0.2
391	0.21
392	0.19
393	0.18
394	0.18
395	0.18
396	0.18
397	0.23
398	0.28
399	0.36
400	0.44
401	0.56
402	0.64
403	0.7
404	0.79
405	0.82
406	0.87
407	0.88
408	0.89
409	0.86
410	0.87
411	0.85
412	0.81
413	0.8
414	0.75
415	0.73
416	0.69
417	0.67
418	0.66
419	0.64
420	0.67
421	0.67
422	0.72
423	0.76
424	0.81
425	0.85
426	0.86
427	0.93
428	0.93
429	0.94
430	0.9
431	0.88
432	0.86
433	0.87
434	0.84
435	0.78
436	0.76
437	0.69
438	0.66
439	0.61
440	0.54
441	0.43
442	0.35
443	0.35
444	0.27
445	0.25
446	0.22
447	0.18
448	0.16
449	0.19
450	0.22
451	0.16
452	0.18
453	0.18
454	0.18
455	0.19
456	0.19
457	0.19
458	0.17
459	0.2
460	0.19
461	0.19
462	0.2
463	0.19
464	0.19
465	0.17
466	0.16
467	0.14
468	0.15
469	0.13
470	0.11
471	0.12
472	0.12
473	0.12
474	0.12
475	0.13

B6K0V5

3D AlphaFold-predicted Structure Viewer