Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JYA4

Protein Details
Accession B6JYA4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-25VKIVKKHTTQFKRHQSDNFKRVHydrophilic
NLS Segment(s)
PositionSequence
41-41R
Subcellular Location(s) mito 11.5, mito_nucl 10.333, cyto_nucl 8.333, nucl 8, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAAVKIVKKHTTQFKRHQSDNFKRVSESWRKPKGIDGVVRRRFRGTIRMPKIGYGSNKKTKYCMPNGLKAFLVRNVADVELLLMQNKTFAAEIASNVSARKRVEIIEKARALGVKVTNAGAKVRSQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.79
4 0.8
5 0.8
6 0.81
7 0.79
8 0.74
9 0.64
10 0.59
11 0.55
12 0.55
13 0.55
14 0.54
15 0.57
16 0.6
17 0.6
18 0.59
19 0.62
20 0.61
21 0.57
22 0.54
23 0.53
24 0.55
25 0.63
26 0.65
27 0.6
28 0.54
29 0.49
30 0.43
31 0.43
32 0.42
33 0.44
34 0.47
35 0.52
36 0.51
37 0.5
38 0.5
39 0.44
40 0.4
41 0.37
42 0.39
43 0.42
44 0.46
45 0.45
46 0.45
47 0.47
48 0.48
49 0.45
50 0.48
51 0.42
52 0.47
53 0.48
54 0.47
55 0.41
56 0.35
57 0.31
58 0.23
59 0.22
60 0.14
61 0.14
62 0.13
63 0.12
64 0.11
65 0.1
66 0.08
67 0.07
68 0.07
69 0.06
70 0.06
71 0.05
72 0.06
73 0.06
74 0.06
75 0.05
76 0.05
77 0.07
78 0.08
79 0.09
80 0.11
81 0.12
82 0.12
83 0.13
84 0.14
85 0.15
86 0.15
87 0.17
88 0.15
89 0.17
90 0.25
91 0.32
92 0.37
93 0.42
94 0.43
95 0.41
96 0.42
97 0.4
98 0.33
99 0.3
100 0.27
101 0.2
102 0.21
103 0.22
104 0.22
105 0.22
106 0.23
107 0.2