Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3CMS3

Protein Details
Accession A0A2H3CMS3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
41-61LRIAADWHKRRPRRGLEHRCWBasic
NLS Segment(s)
Subcellular Location(s) mito 17.5, cyto_mito 10.5, extr 4, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MVWFTKGGRRGWRDICAYLSGLSRVGTGYITAANRDFRGQLRIAADWHKRRPRRGLEHRCW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.47
3 0.39
4 0.35
5 0.28
6 0.24
7 0.19
8 0.15
9 0.13
10 0.11
11 0.09
12 0.08
13 0.07
14 0.06
15 0.05
16 0.07
17 0.07
18 0.07
19 0.09
20 0.09
21 0.1
22 0.11
23 0.12
24 0.11
25 0.15
26 0.15
27 0.17
28 0.18
29 0.18
30 0.2
31 0.26
32 0.34
33 0.38
34 0.47
35 0.54
36 0.58
37 0.65
38 0.73
39 0.76
40 0.78
41 0.82