Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JWS6

Protein Details
Accession B6JWS6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
38-59IEKDRERKQRRQERINDFNRQKBasic
NLS Segment(s)
Subcellular Location(s) extr 17, mito 4, golg 3, E.R. 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR031568  Pet117  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF15786  PET117  
Amino Acid Sequences MSTASKVSIGLASLFCVGMIAFVHQSQGSEKQNMQLGIEKDRERKQRRQERINDFNRQKQLYSTYVVDQPVQAQPISAPPDDLDENKAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.08
4 0.07
5 0.06
6 0.06
7 0.06
8 0.07
9 0.07
10 0.08
11 0.08
12 0.09
13 0.1
14 0.16
15 0.18
16 0.2
17 0.2
18 0.22
19 0.26
20 0.25
21 0.24
22 0.23
23 0.21
24 0.22
25 0.27
26 0.26
27 0.27
28 0.34
29 0.43
30 0.44
31 0.51
32 0.58
33 0.64
34 0.71
35 0.75
36 0.78
37 0.78
38 0.82
39 0.81
40 0.8
41 0.74
42 0.72
43 0.69
44 0.61
45 0.51
46 0.43
47 0.41
48 0.33
49 0.33
50 0.28
51 0.24
52 0.26
53 0.26
54 0.24
55 0.2
56 0.2
57 0.19
58 0.18
59 0.15
60 0.13
61 0.12
62 0.17
63 0.21
64 0.19
65 0.17
66 0.16
67 0.21
68 0.23
69 0.24