Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3E627

Protein Details
Accession A0A2H3E627    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
61-86IVKEEKSQGKRSKDRFKERQARKAATHydrophilic
NLS Segment(s)
PositionSequence
5-10RKKLRK
69-82GKRSKDRFKERQAR
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003323  OTU_dom  
IPR038765  Papain-like_cys_pep_sf  
Pfam View protein in Pfam  
PF02338  OTU  
PROSITE View protein in PROSITE  
PS50802  OTU  
CDD cd22748  OTU_OTUD6-like  
Amino Acid Sequences MAGPRKKLRKAGNGLPPPPPPPEVDDDDLMNDLMAQLDSRDGTVRAESAAVLQDMTLEKDIVKEEKSQGKRSKDRFKERQARKAATLSNAFSPDDPEASRQLELEARQEEESIKRVCTELKVQIHEINPDGHCLFSAVADQLSLLGILPPVQANYVTARLAASNYMLSHPDDFLPFLPSTSGEDAAGSYDEGLISPREFEQYCTTIRDTGAWGGEPEILALSRAFNVPIHVVQGGTPPIVVHNPNGGPGEDDLNVKHAVRISYHRRMYGLGEHYNSLRPSSGLTKMTRVIENILS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.74
3 0.68
4 0.61
5 0.56
6 0.48
7 0.39
8 0.35
9 0.37
10 0.37
11 0.37
12 0.35
13 0.32
14 0.32
15 0.3
16 0.25
17 0.18
18 0.12
19 0.08
20 0.07
21 0.06
22 0.05
23 0.05
24 0.06
25 0.07
26 0.07
27 0.09
28 0.09
29 0.1
30 0.11
31 0.12
32 0.11
33 0.11
34 0.1
35 0.1
36 0.11
37 0.1
38 0.09
39 0.08
40 0.09
41 0.1
42 0.11
43 0.11
44 0.09
45 0.09
46 0.11
47 0.13
48 0.14
49 0.15
50 0.17
51 0.22
52 0.31
53 0.36
54 0.44
55 0.5
56 0.58
57 0.65
58 0.71
59 0.76
60 0.77
61 0.83
62 0.83
63 0.87
64 0.87
65 0.87
66 0.87
67 0.85
68 0.79
69 0.71
70 0.67
71 0.6
72 0.54
73 0.49
74 0.41
75 0.35
76 0.33
77 0.29
78 0.23
79 0.22
80 0.18
81 0.16
82 0.15
83 0.14
84 0.14
85 0.16
86 0.16
87 0.13
88 0.14
89 0.15
90 0.15
91 0.17
92 0.16
93 0.16
94 0.16
95 0.16
96 0.16
97 0.15
98 0.19
99 0.16
100 0.16
101 0.14
102 0.15
103 0.15
104 0.17
105 0.19
106 0.22
107 0.25
108 0.27
109 0.28
110 0.31
111 0.31
112 0.3
113 0.26
114 0.22
115 0.18
116 0.18
117 0.16
118 0.12
119 0.11
120 0.11
121 0.1
122 0.06
123 0.07
124 0.05
125 0.05
126 0.05
127 0.05
128 0.04
129 0.04
130 0.04
131 0.03
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.04
138 0.04
139 0.04
140 0.05
141 0.06
142 0.07
143 0.07
144 0.07
145 0.07
146 0.07
147 0.08
148 0.07
149 0.06
150 0.06
151 0.06
152 0.07
153 0.08
154 0.08
155 0.09
156 0.09
157 0.09
158 0.09
159 0.09
160 0.09
161 0.11
162 0.1
163 0.1
164 0.09
165 0.09
166 0.12
167 0.12
168 0.12
169 0.09
170 0.09
171 0.09
172 0.09
173 0.09
174 0.06
175 0.05
176 0.04
177 0.04
178 0.04
179 0.05
180 0.05
181 0.05
182 0.06
183 0.07
184 0.1
185 0.1
186 0.13
187 0.16
188 0.18
189 0.19
190 0.22
191 0.22
192 0.21
193 0.21
194 0.2
195 0.17
196 0.17
197 0.16
198 0.13
199 0.12
200 0.12
201 0.12
202 0.1
203 0.09
204 0.07
205 0.06
206 0.07
207 0.06
208 0.06
209 0.07
210 0.07
211 0.08
212 0.08
213 0.09
214 0.11
215 0.11
216 0.12
217 0.11
218 0.11
219 0.11
220 0.14
221 0.13
222 0.11
223 0.11
224 0.09
225 0.1
226 0.13
227 0.14
228 0.12
229 0.17
230 0.17
231 0.2
232 0.21
233 0.2
234 0.18
235 0.18
236 0.2
237 0.16
238 0.16
239 0.14
240 0.16
241 0.17
242 0.16
243 0.16
244 0.16
245 0.17
246 0.19
247 0.28
248 0.34
249 0.42
250 0.46
251 0.46
252 0.44
253 0.44
254 0.45
255 0.44
256 0.42
257 0.38
258 0.36
259 0.36
260 0.37
261 0.41
262 0.37
263 0.31
264 0.25
265 0.19
266 0.21
267 0.24
268 0.29
269 0.29
270 0.31
271 0.34
272 0.39
273 0.42
274 0.41
275 0.38