Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3ET69

Protein Details
Accession A0A2H3ET69   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-39SCTLKGCKRLKESKVKRKSSLSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 9, cyto 6.5, mito 3, pero 3, E.R. 3
Family & Domain DBs
Amino Acid Sequences LELFFPDVCKVRNLPIVSCTLKGCKRLKESKVKRKSSLSCNNICHVIKTLSNSSDYDNCLFLALLVTGFNSLLCLTELSMPDLKKAQNWRKIIQRTTIEWLPEEYTFFLPAHKADTAFEKNKVIILSDDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.3
3 0.35
4 0.34
5 0.34
6 0.31
7 0.32
8 0.33
9 0.4
10 0.43
11 0.44
12 0.51
13 0.59
14 0.65
15 0.69
16 0.77
17 0.79
18 0.84
19 0.83
20 0.8
21 0.8
22 0.79
23 0.78
24 0.77
25 0.73
26 0.7
27 0.66
28 0.62
29 0.59
30 0.51
31 0.42
32 0.34
33 0.29
34 0.23
35 0.23
36 0.24
37 0.19
38 0.21
39 0.2
40 0.19
41 0.2
42 0.2
43 0.17
44 0.15
45 0.14
46 0.12
47 0.11
48 0.09
49 0.07
50 0.05
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.05
63 0.08
64 0.08
65 0.1
66 0.14
67 0.13
68 0.14
69 0.16
70 0.16
71 0.18
72 0.28
73 0.34
74 0.4
75 0.44
76 0.48
77 0.55
78 0.62
79 0.61
80 0.59
81 0.55
82 0.5
83 0.53
84 0.51
85 0.42
86 0.36
87 0.34
88 0.28
89 0.24
90 0.22
91 0.17
92 0.15
93 0.16
94 0.15
95 0.14
96 0.14
97 0.14
98 0.16
99 0.15
100 0.14
101 0.14
102 0.22
103 0.29
104 0.31
105 0.34
106 0.33
107 0.32
108 0.34
109 0.34
110 0.28