Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3D0P9

Protein Details
Accession A0A2H3D0P9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
130-153LGSGSSRRTCKKKSPRKRCSAAHGHydrophilic
NLS Segment(s)
PositionSequence
141-146KKSPRK
Subcellular Location(s) nucl 19, cyto_nucl 15, cyto 7
Family & Domain DBs
Amino Acid Sequences MLDTFDSPEPSVAEPSAKGQTPPPAGCSKPGPSQSSDSAQPVEVSLHSEDEVSDSNSHSSAVGSPLEPLGHNSDSEQHSAALAQDPNALDEDTMADIDQLDEERLAMLGEELLMTKELLKLNQTIEAELLGSGSSRRTCKKKSPRKRCSAAHG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.22
4 0.21
5 0.2
6 0.21
7 0.28
8 0.33
9 0.33
10 0.34
11 0.35
12 0.35
13 0.37
14 0.39
15 0.36
16 0.37
17 0.42
18 0.41
19 0.39
20 0.43
21 0.43
22 0.41
23 0.39
24 0.33
25 0.29
26 0.26
27 0.22
28 0.18
29 0.16
30 0.12
31 0.12
32 0.11
33 0.1
34 0.1
35 0.1
36 0.09
37 0.1
38 0.11
39 0.1
40 0.1
41 0.1
42 0.1
43 0.1
44 0.1
45 0.09
46 0.08
47 0.07
48 0.08
49 0.08
50 0.07
51 0.08
52 0.08
53 0.08
54 0.08
55 0.08
56 0.11
57 0.11
58 0.1
59 0.1
60 0.15
61 0.15
62 0.16
63 0.15
64 0.11
65 0.11
66 0.11
67 0.11
68 0.09
69 0.08
70 0.07
71 0.09
72 0.09
73 0.09
74 0.1
75 0.1
76 0.07
77 0.07
78 0.07
79 0.06
80 0.06
81 0.05
82 0.04
83 0.04
84 0.04
85 0.05
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.03
95 0.03
96 0.03
97 0.03
98 0.03
99 0.04
100 0.05
101 0.05
102 0.05
103 0.09
104 0.1
105 0.11
106 0.12
107 0.14
108 0.15
109 0.2
110 0.2
111 0.17
112 0.16
113 0.15
114 0.14
115 0.12
116 0.11
117 0.06
118 0.06
119 0.05
120 0.09
121 0.12
122 0.17
123 0.25
124 0.33
125 0.4
126 0.51
127 0.62
128 0.7
129 0.78
130 0.84
131 0.88
132 0.91
133 0.94