Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K3Q4

Protein Details
Accession B6K3Q4    Localization Confidence Low Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
94-114SRTDWFYEKKRYKNAGKDMPGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, cyto_nucl 11, nucl 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR005345  PHF5  
Gene Ontology GO:0071011  C:precatalytic spliceosome  
GO:0005686  C:U2 snRNP  
GO:0045292  P:mRNA cis splicing, via spliceosome  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF03660  PHF5  
Amino Acid Sequences MSKHHPDLVLCRRQTGISIGRLCERCDGKCPICDSYVRPKTLVRICDECAFGSSQDRCIICGAPGVSDCYYCDECTRLEYDRDGCPRVVNLGTSRTDWFYEKKRYKNAGKDMPGPMY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.36
3 0.32
4 0.31
5 0.33
6 0.33
7 0.39
8 0.4
9 0.39
10 0.4
11 0.37
12 0.3
13 0.33
14 0.39
15 0.35
16 0.38
17 0.4
18 0.35
19 0.34
20 0.35
21 0.34
22 0.37
23 0.42
24 0.38
25 0.36
26 0.34
27 0.4
28 0.43
29 0.42
30 0.35
31 0.32
32 0.33
33 0.34
34 0.34
35 0.27
36 0.23
37 0.2
38 0.16
39 0.16
40 0.15
41 0.13
42 0.16
43 0.16
44 0.15
45 0.15
46 0.15
47 0.11
48 0.13
49 0.11
50 0.08
51 0.09
52 0.11
53 0.1
54 0.1
55 0.1
56 0.12
57 0.14
58 0.13
59 0.14
60 0.12
61 0.13
62 0.14
63 0.16
64 0.14
65 0.14
66 0.17
67 0.19
68 0.24
69 0.27
70 0.28
71 0.26
72 0.25
73 0.24
74 0.24
75 0.22
76 0.18
77 0.17
78 0.19
79 0.21
80 0.22
81 0.23
82 0.22
83 0.23
84 0.23
85 0.27
86 0.31
87 0.4
88 0.46
89 0.53
90 0.61
91 0.68
92 0.75
93 0.79
94 0.82
95 0.81
96 0.79
97 0.78