Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DSI9

Protein Details
Accession A0A2H3DSI9    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
124-156ACTDEPPPKKAKRPKQCRKCEYKDKCNGRQNIGHydrophilic
NLS Segment(s)
PositionSequence
131-137PKKAKRP
Subcellular Location(s) nucl 22, cyto 5
Family & Domain DBs
Amino Acid Sequences MTSDDKFADEWSIFDNEALNSLVPESSTSRSTCHHTGLDFASKEKSSEAYPDPGVSHSMPVLSLETIDSSLGLSGVAQMPSKLHHRTSQAGTPKVNMDSSNPCGHALSLQDKQKEIGKRLAAKACTDEPPPKKAKRPKQCRKCEYKDKCNGRQNIGLCRNPCKDCGIVQCRGHNTNRPNLPCHLAWD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.12
4 0.14
5 0.14
6 0.11
7 0.09
8 0.1
9 0.09
10 0.08
11 0.1
12 0.11
13 0.13
14 0.16
15 0.16
16 0.18
17 0.2
18 0.27
19 0.27
20 0.28
21 0.28
22 0.25
23 0.28
24 0.3
25 0.34
26 0.28
27 0.27
28 0.27
29 0.25
30 0.25
31 0.23
32 0.2
33 0.14
34 0.19
35 0.2
36 0.2
37 0.2
38 0.21
39 0.21
40 0.2
41 0.22
42 0.17
43 0.15
44 0.11
45 0.11
46 0.09
47 0.09
48 0.09
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.06
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.03
61 0.04
62 0.05
63 0.06
64 0.06
65 0.06
66 0.06
67 0.08
68 0.13
69 0.14
70 0.15
71 0.18
72 0.21
73 0.25
74 0.28
75 0.32
76 0.35
77 0.35
78 0.34
79 0.31
80 0.29
81 0.26
82 0.24
83 0.18
84 0.15
85 0.16
86 0.19
87 0.2
88 0.19
89 0.18
90 0.18
91 0.17
92 0.15
93 0.14
94 0.15
95 0.18
96 0.22
97 0.23
98 0.23
99 0.24
100 0.29
101 0.31
102 0.29
103 0.3
104 0.31
105 0.35
106 0.4
107 0.44
108 0.4
109 0.37
110 0.37
111 0.34
112 0.31
113 0.3
114 0.33
115 0.31
116 0.37
117 0.43
118 0.45
119 0.52
120 0.59
121 0.67
122 0.7
123 0.78
124 0.82
125 0.86
126 0.92
127 0.92
128 0.92
129 0.92
130 0.92
131 0.91
132 0.9
133 0.9
134 0.89
135 0.88
136 0.87
137 0.82
138 0.77
139 0.73
140 0.66
141 0.66
142 0.65
143 0.6
144 0.54
145 0.56
146 0.57
147 0.52
148 0.5
149 0.44
150 0.38
151 0.37
152 0.45
153 0.43
154 0.45
155 0.48
156 0.53
157 0.55
158 0.58
159 0.58
160 0.56
161 0.56
162 0.57
163 0.62
164 0.59
165 0.57
166 0.56
167 0.57