Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3E5M7

Protein Details
Accession A0A2H3E5M7    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
52-71LHCMRVTPPKRQTHRPAINFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MGVHIRELKVRPRKRQMDGMCGVQLAAMLGCWAASKDIQSMGTCRAAAENLLHCMRVTPPKRQTHRPAINFHLARLGKRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.75
4 0.74
5 0.69
6 0.63
7 0.52
8 0.44
9 0.37
10 0.27
11 0.21
12 0.12
13 0.08
14 0.04
15 0.03
16 0.03
17 0.03
18 0.03
19 0.03
20 0.04
21 0.04
22 0.05
23 0.06
24 0.07
25 0.08
26 0.08
27 0.09
28 0.11
29 0.12
30 0.11
31 0.1
32 0.1
33 0.09
34 0.09
35 0.1
36 0.1
37 0.12
38 0.13
39 0.13
40 0.12
41 0.13
42 0.15
43 0.23
44 0.25
45 0.31
46 0.4
47 0.5
48 0.56
49 0.65
50 0.71
51 0.73
52 0.8
53 0.77
54 0.75
55 0.72
56 0.76
57 0.67
58 0.58
59 0.56
60 0.47