Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3CXU9

Protein Details
Accession A0A2H3CXU9    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
16-36AFKFKFCLKHQRKVEFRRPCEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 10.5, cyto_nucl 7, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027512  EIF3A  
Gene Ontology GO:0005852  C:eukaryotic translation initiation factor 3 complex  
GO:0003743  F:translation initiation factor activity  
Amino Acid Sequences MLKNKEVIYQQISQQAFKFKFCLKHQRKVEFRRPCEALRLHLSHTVKYSHQPHSINLFDQILYSSTWIHDSLSSTLHFSSNYGQRYSAPSRTSTIC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.34
4 0.33
5 0.33
6 0.31
7 0.38
8 0.43
9 0.52
10 0.51
11 0.59
12 0.66
13 0.72
14 0.77
15 0.78
16 0.82
17 0.81
18 0.77
19 0.74
20 0.69
21 0.6
22 0.58
23 0.5
24 0.44
25 0.4
26 0.38
27 0.32
28 0.34
29 0.34
30 0.28
31 0.28
32 0.25
33 0.2
34 0.24
35 0.27
36 0.26
37 0.31
38 0.31
39 0.31
40 0.35
41 0.35
42 0.29
43 0.26
44 0.22
45 0.16
46 0.15
47 0.14
48 0.09
49 0.08
50 0.08
51 0.07
52 0.07
53 0.08
54 0.08
55 0.08
56 0.09
57 0.11
58 0.12
59 0.13
60 0.14
61 0.14
62 0.14
63 0.14
64 0.13
65 0.12
66 0.17
67 0.22
68 0.25
69 0.25
70 0.25
71 0.26
72 0.33
73 0.38
74 0.38
75 0.34
76 0.33