Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3EAD4

Protein Details
Accession A0A2H3EAD4   
Localization Confidence High
Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
21-54RDPLLTSIRRPKKLRKAPPPVKPRYPPNNRFTARHydrophilic
223-244QNSPSGSPRRRQHHRLLYPSSHHydrophilic
NLS Segment(s)
PositionSequence
29-46RRPKKLRKAPPPVKPRYP
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003124  WH2_dom  
Gene Ontology GO:0030479  C:actin cortical patch  
GO:0003779  F:actin binding  
PROSITE View protein in PROSITE  
PS51082  WH2  
Amino Acid Sequences MSLSWLSKNLHFDDSDAGDDRDPLLTSIRRPKKLRKAPPPVKPRYPPNNRFTARRNLQASKVVEGHGYLKNASDLIQQHRGSLASNTPSLDTRWAQLFTVAPVLRKLTKGRQKPQEWCDNARQLLKDVQKKLRDARRRSRGSASIFSFISLGSTRRSRKHPASSNQSHSTYRFPKDTPGHHYHPRPRNPGTVMSPSSFHHVVELKPLPAIPDSGRIFEEWGSQNSPSGSPRRRQHHRLLYPSSHLSKTASPHL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.26
4 0.23
5 0.2
6 0.2
7 0.2
8 0.17
9 0.15
10 0.12
11 0.15
12 0.17
13 0.23
14 0.34
15 0.42
16 0.5
17 0.55
18 0.65
19 0.71
20 0.79
21 0.84
22 0.84
23 0.86
24 0.87
25 0.91
26 0.91
27 0.89
28 0.88
29 0.84
30 0.83
31 0.83
32 0.84
33 0.83
34 0.79
35 0.8
36 0.74
37 0.72
38 0.68
39 0.68
40 0.62
41 0.61
42 0.62
43 0.55
44 0.56
45 0.57
46 0.53
47 0.46
48 0.42
49 0.34
50 0.28
51 0.25
52 0.25
53 0.2
54 0.19
55 0.15
56 0.15
57 0.14
58 0.14
59 0.14
60 0.14
61 0.15
62 0.19
63 0.27
64 0.27
65 0.27
66 0.27
67 0.27
68 0.23
69 0.22
70 0.2
71 0.14
72 0.15
73 0.15
74 0.15
75 0.16
76 0.16
77 0.18
78 0.15
79 0.14
80 0.16
81 0.16
82 0.15
83 0.15
84 0.15
85 0.12
86 0.18
87 0.16
88 0.14
89 0.14
90 0.16
91 0.16
92 0.18
93 0.21
94 0.24
95 0.32
96 0.4
97 0.48
98 0.56
99 0.61
100 0.67
101 0.7
102 0.7
103 0.66
104 0.61
105 0.59
106 0.54
107 0.49
108 0.44
109 0.38
110 0.3
111 0.32
112 0.34
113 0.34
114 0.34
115 0.39
116 0.4
117 0.43
118 0.49
119 0.52
120 0.55
121 0.57
122 0.63
123 0.66
124 0.68
125 0.69
126 0.67
127 0.64
128 0.59
129 0.57
130 0.49
131 0.41
132 0.36
133 0.33
134 0.27
135 0.2
136 0.16
137 0.11
138 0.09
139 0.1
140 0.16
141 0.19
142 0.24
143 0.29
144 0.36
145 0.43
146 0.52
147 0.59
148 0.62
149 0.68
150 0.71
151 0.74
152 0.71
153 0.67
154 0.58
155 0.51
156 0.5
157 0.45
158 0.41
159 0.37
160 0.32
161 0.38
162 0.42
163 0.45
164 0.46
165 0.48
166 0.5
167 0.54
168 0.62
169 0.64
170 0.67
171 0.71
172 0.7
173 0.66
174 0.66
175 0.62
176 0.6
177 0.56
178 0.53
179 0.47
180 0.41
181 0.39
182 0.33
183 0.36
184 0.3
185 0.24
186 0.21
187 0.2
188 0.19
189 0.26
190 0.28
191 0.22
192 0.22
193 0.22
194 0.2
195 0.19
196 0.21
197 0.14
198 0.2
199 0.21
200 0.23
201 0.23
202 0.22
203 0.23
204 0.21
205 0.26
206 0.2
207 0.22
208 0.23
209 0.22
210 0.24
211 0.24
212 0.26
213 0.24
214 0.31
215 0.34
216 0.4
217 0.49
218 0.57
219 0.65
220 0.71
221 0.78
222 0.79
223 0.83
224 0.83
225 0.83
226 0.78
227 0.75
228 0.75
229 0.69
230 0.59
231 0.5
232 0.44
233 0.4