Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3D0B8

Protein Details
Accession A0A2H3D0B8   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-87IQYPPSSRYRYPPRPRARRYPPKNPSLGSHydrophilic
NLS Segment(s)
PositionSequence
73-77PRARR
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MKYYEELEKEGAQRITDQSITEEANVDEENTQHAHGLDSSQLRRGCSACHIPLARLSQIQYPPSSRYRYPPRPRARRYPPKNPSLGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.22
4 0.21
5 0.17
6 0.18
7 0.18
8 0.16
9 0.15
10 0.12
11 0.13
12 0.12
13 0.11
14 0.09
15 0.08
16 0.09
17 0.09
18 0.09
19 0.08
20 0.08
21 0.08
22 0.08
23 0.08
24 0.09
25 0.12
26 0.12
27 0.17
28 0.18
29 0.18
30 0.19
31 0.19
32 0.17
33 0.18
34 0.22
35 0.18
36 0.22
37 0.22
38 0.21
39 0.25
40 0.27
41 0.24
42 0.2
43 0.21
44 0.21
45 0.23
46 0.25
47 0.23
48 0.23
49 0.26
50 0.3
51 0.34
52 0.3
53 0.36
54 0.45
55 0.54
56 0.62
57 0.69
58 0.75
59 0.81
60 0.87
61 0.89
62 0.89
63 0.9
64 0.89
65 0.89
66 0.88
67 0.86