Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3CXV7

Protein Details
Accession A0A2H3CXV7    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
252-271NKQQRRYLKRWLEKLRVNNGHydrophilic
NLS Segment(s)
PositionSequence
233-257NPRRRLRGGRLAGYRAKVVNKQQRR
Subcellular Location(s) mito 8, nucl 7.5, cyto_nucl 7.333, cyto 6, cyto_pero 5.333, pero 3.5
Family & Domain DBs
Amino Acid Sequences MWRHWLEILGWGDLTYTSIPVQLCPSGFDISGMGYARIRLNGIGKLVYSRARKTATPTVTSLKPPSLSPSVNATYGCPMRDVVFELVVLEMGKDGGRVCGRGNAQAQLHPHESPTVTKNKSPRYQNGAPRLHAEVHTCMDRAPIQRIHRPFSTYPCCTKSQPSRRQRASLPLMAMPSQGNRIVHVLLMEHIDGKDFHILVPVQKAKGICPAHILAMALNLNLGAIPRNVIVRNPRRRLRGGRLAGYRAKVVNKQQRRYLKRWLEKLRVNNGGNRPGWPTIVLHKNPRVLKDNPPRSTSVNTIFSSMYRVAPSCPAVAAEKWQHIIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.1
3 0.09
4 0.08
5 0.12
6 0.12
7 0.13
8 0.16
9 0.17
10 0.17
11 0.18
12 0.21
13 0.19
14 0.19
15 0.18
16 0.15
17 0.14
18 0.16
19 0.15
20 0.13
21 0.11
22 0.13
23 0.14
24 0.15
25 0.15
26 0.14
27 0.17
28 0.18
29 0.19
30 0.18
31 0.17
32 0.18
33 0.2
34 0.25
35 0.27
36 0.27
37 0.31
38 0.33
39 0.35
40 0.4
41 0.47
42 0.45
43 0.44
44 0.45
45 0.44
46 0.44
47 0.47
48 0.42
49 0.36
50 0.32
51 0.29
52 0.31
53 0.31
54 0.29
55 0.27
56 0.31
57 0.29
58 0.3
59 0.29
60 0.25
61 0.25
62 0.26
63 0.24
64 0.18
65 0.17
66 0.16
67 0.17
68 0.19
69 0.15
70 0.14
71 0.13
72 0.12
73 0.12
74 0.11
75 0.1
76 0.06
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.08
83 0.09
84 0.1
85 0.11
86 0.16
87 0.17
88 0.21
89 0.23
90 0.23
91 0.24
92 0.26
93 0.27
94 0.26
95 0.28
96 0.23
97 0.22
98 0.19
99 0.19
100 0.19
101 0.21
102 0.25
103 0.25
104 0.28
105 0.35
106 0.42
107 0.48
108 0.52
109 0.55
110 0.55
111 0.61
112 0.66
113 0.69
114 0.64
115 0.58
116 0.55
117 0.5
118 0.42
119 0.35
120 0.3
121 0.22
122 0.19
123 0.19
124 0.16
125 0.14
126 0.14
127 0.16
128 0.16
129 0.18
130 0.22
131 0.25
132 0.31
133 0.34
134 0.37
135 0.35
136 0.38
137 0.35
138 0.37
139 0.4
140 0.37
141 0.38
142 0.38
143 0.39
144 0.36
145 0.42
146 0.45
147 0.49
148 0.56
149 0.61
150 0.67
151 0.68
152 0.7
153 0.65
154 0.63
155 0.58
156 0.5
157 0.43
158 0.34
159 0.31
160 0.27
161 0.26
162 0.17
163 0.12
164 0.11
165 0.11
166 0.1
167 0.1
168 0.11
169 0.1
170 0.1
171 0.1
172 0.08
173 0.07
174 0.08
175 0.07
176 0.06
177 0.06
178 0.07
179 0.07
180 0.07
181 0.09
182 0.08
183 0.08
184 0.1
185 0.11
186 0.11
187 0.17
188 0.18
189 0.17
190 0.19
191 0.19
192 0.17
193 0.25
194 0.25
195 0.19
196 0.21
197 0.21
198 0.2
199 0.2
200 0.2
201 0.11
202 0.12
203 0.12
204 0.08
205 0.07
206 0.06
207 0.05
208 0.05
209 0.05
210 0.04
211 0.04
212 0.05
213 0.06
214 0.08
215 0.09
216 0.12
217 0.22
218 0.31
219 0.41
220 0.49
221 0.55
222 0.59
223 0.66
224 0.71
225 0.71
226 0.71
227 0.67
228 0.67
229 0.65
230 0.65
231 0.62
232 0.55
233 0.48
234 0.4
235 0.37
236 0.35
237 0.4
238 0.45
239 0.51
240 0.55
241 0.61
242 0.69
243 0.74
244 0.74
245 0.75
246 0.75
247 0.75
248 0.79
249 0.8
250 0.79
251 0.78
252 0.81
253 0.79
254 0.77
255 0.7
256 0.67
257 0.64
258 0.62
259 0.56
260 0.49
261 0.44
262 0.37
263 0.36
264 0.29
265 0.25
266 0.26
267 0.34
268 0.37
269 0.41
270 0.45
271 0.52
272 0.54
273 0.58
274 0.56
275 0.5
276 0.56
277 0.59
278 0.65
279 0.62
280 0.62
281 0.6
282 0.58
283 0.59
284 0.55
285 0.51
286 0.47
287 0.43
288 0.42
289 0.39
290 0.35
291 0.35
292 0.3
293 0.24
294 0.2
295 0.2
296 0.2
297 0.24
298 0.25
299 0.22
300 0.2
301 0.2
302 0.21
303 0.21
304 0.27
305 0.28
306 0.3