Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K7E5

Protein Details
Accession B6K7E5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSETKRGRPPTRRQHLFTKDLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0046982  F:protein heterodimerization activity  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MSSETKRGRPPTRRQHLFTKDLKSLMFAFGDDINPAPDSVNVLEEIVVDYINEMCLEAARIAGNRNKVKVDDFKFALRNDSKKLGRVEELLVLQKVIADARRIVDCNADT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.83
3 0.81
4 0.79
5 0.75
6 0.71
7 0.63
8 0.57
9 0.52
10 0.43
11 0.36
12 0.3
13 0.23
14 0.16
15 0.14
16 0.13
17 0.13
18 0.11
19 0.1
20 0.09
21 0.09
22 0.09
23 0.08
24 0.07
25 0.08
26 0.08
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.03
41 0.03
42 0.03
43 0.04
44 0.04
45 0.04
46 0.04
47 0.05
48 0.07
49 0.1
50 0.18
51 0.19
52 0.21
53 0.22
54 0.22
55 0.26
56 0.32
57 0.34
58 0.32
59 0.32
60 0.35
61 0.37
62 0.37
63 0.41
64 0.37
65 0.36
66 0.34
67 0.41
68 0.38
69 0.4
70 0.43
71 0.39
72 0.37
73 0.36
74 0.33
75 0.29
76 0.3
77 0.27
78 0.24
79 0.21
80 0.18
81 0.16
82 0.14
83 0.13
84 0.13
85 0.12
86 0.13
87 0.16
88 0.2
89 0.21
90 0.22