Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K6L8

Protein Details
Accession B6K6L8    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MGKRKAKAKAPPKRKTPPLDTTFHydrophilic
NLS Segment(s)
PositionSequence
3-15KRKAKAKAPPKRK
Subcellular Location(s) mito 17.5, cyto_mito 10.833, nucl 4.5, cyto_nucl 4.333, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0008023  C:transcription elongation factor complex  
GO:0046872  F:metal ion binding  
GO:0000993  F:RNA polymerase II complex binding  
GO:0003746  F:translation elongation factor activity  
GO:0006368  P:transcription elongation by RNA polymerase II  
GO:0045815  P:transcription initiation-coupled chromatin remodeling  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKAKAKAPPKRKTPPLDTTFTCLFCNHEKSVSCSLDKQAGVGNLHCKICGQSHQCIINALSAPIDIYSDWIDACDAIAKQESAYDDEKPSRRYAD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.83
4 0.83
5 0.77
6 0.74
7 0.66
8 0.62
9 0.56
10 0.49
11 0.41
12 0.31
13 0.29
14 0.27
15 0.3
16 0.25
17 0.26
18 0.25
19 0.3
20 0.37
21 0.35
22 0.32
23 0.28
24 0.29
25 0.29
26 0.28
27 0.23
28 0.18
29 0.18
30 0.18
31 0.17
32 0.19
33 0.17
34 0.17
35 0.16
36 0.14
37 0.13
38 0.13
39 0.19
40 0.19
41 0.2
42 0.24
43 0.26
44 0.27
45 0.27
46 0.26
47 0.22
48 0.19
49 0.15
50 0.11
51 0.09
52 0.09
53 0.07
54 0.07
55 0.04
56 0.06
57 0.07
58 0.07
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.08
65 0.07
66 0.08
67 0.1
68 0.1
69 0.1
70 0.13
71 0.14
72 0.15
73 0.17
74 0.19
75 0.22
76 0.3
77 0.35
78 0.36