Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K5U3

Protein Details
Accession B6K5U3    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
61-84EMNVEELRKKRHRRLQIKGKATVSHydrophilic
NLS Segment(s)
PositionSequence
68-78RKKRHRRLQIK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003107  HAT  
IPR011990  TPR-like_helical_dom_sf  
IPR013949  Utp6  
Gene Ontology GO:0034388  C:Pwp2p-containing subcomplex of 90S preribosome  
GO:0032040  C:small-subunit processome  
GO:0030515  F:snoRNA binding  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF08640  U3_assoc_6  
Amino Acid Sequences MAEKVQYHLELSVPELEDLSKKKIFNKAELTAIVKKRTQFEQSLARRQVKLADYLKYIQFEMNVEELRKKRHRRLQIKGKATVSDYAGPRRIMYLFFCATNRFFGDIALWVDYIRYAQRIQAYHHAGKLCALALQKHPNNIMLWMLACDHEFSLNANMESARVLMQRGLRLNNDSPDLWAAYFRVELAYLAKLYAREQLLLAPVASDENKEKDNAEEGEDNDADHIKLPSVSVEEYRNDSKNDMPSVADELPATTTDSERHAAFVNVFLTIIKSARTSLSLVGWAQFLISITDVLIESQLLPVARELLEKHAAPMISETLGTCVAEKQPFRKFGELMHRYVLYPLYSKIDTVYPFESKTKFLSPEHVDMKKLVLSRLSSPSIADALSECLNRYTECAQNAMVASIVRAEYIRLFIHTLAALASLGINSTLQLVFDTIQQDAFQQLTRIAGVTMDDHLQTLHRQLQARLHPETIAQSSASQGSISVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.17
4 0.21
5 0.24
6 0.28
7 0.27
8 0.28
9 0.34
10 0.43
11 0.46
12 0.5
13 0.55
14 0.52
15 0.53
16 0.54
17 0.54
18 0.54
19 0.55
20 0.51
21 0.46
22 0.46
23 0.45
24 0.48
25 0.49
26 0.44
27 0.45
28 0.51
29 0.56
30 0.63
31 0.66
32 0.66
33 0.6
34 0.57
35 0.58
36 0.5
37 0.51
38 0.44
39 0.41
40 0.39
41 0.42
42 0.44
43 0.38
44 0.36
45 0.28
46 0.25
47 0.22
48 0.21
49 0.21
50 0.21
51 0.2
52 0.27
53 0.29
54 0.37
55 0.45
56 0.51
57 0.58
58 0.65
59 0.75
60 0.78
61 0.86
62 0.88
63 0.88
64 0.88
65 0.85
66 0.78
67 0.69
68 0.61
69 0.54
70 0.46
71 0.42
72 0.37
73 0.36
74 0.37
75 0.35
76 0.33
77 0.31
78 0.29
79 0.24
80 0.23
81 0.23
82 0.2
83 0.22
84 0.22
85 0.23
86 0.23
87 0.24
88 0.23
89 0.19
90 0.18
91 0.16
92 0.16
93 0.16
94 0.16
95 0.15
96 0.13
97 0.11
98 0.11
99 0.11
100 0.11
101 0.09
102 0.1
103 0.09
104 0.12
105 0.17
106 0.19
107 0.23
108 0.3
109 0.37
110 0.37
111 0.4
112 0.38
113 0.33
114 0.32
115 0.3
116 0.21
117 0.16
118 0.15
119 0.15
120 0.19
121 0.29
122 0.3
123 0.32
124 0.32
125 0.32
126 0.31
127 0.29
128 0.24
129 0.15
130 0.13
131 0.11
132 0.11
133 0.09
134 0.09
135 0.08
136 0.08
137 0.08
138 0.07
139 0.08
140 0.12
141 0.13
142 0.12
143 0.12
144 0.12
145 0.11
146 0.12
147 0.11
148 0.08
149 0.07
150 0.08
151 0.1
152 0.12
153 0.16
154 0.18
155 0.2
156 0.2
157 0.24
158 0.26
159 0.25
160 0.26
161 0.22
162 0.2
163 0.19
164 0.18
165 0.14
166 0.12
167 0.1
168 0.08
169 0.08
170 0.07
171 0.06
172 0.06
173 0.06
174 0.07
175 0.08
176 0.07
177 0.07
178 0.08
179 0.08
180 0.09
181 0.13
182 0.12
183 0.11
184 0.12
185 0.12
186 0.13
187 0.13
188 0.12
189 0.07
190 0.07
191 0.07
192 0.07
193 0.07
194 0.08
195 0.09
196 0.1
197 0.1
198 0.11
199 0.11
200 0.14
201 0.14
202 0.15
203 0.15
204 0.15
205 0.18
206 0.17
207 0.16
208 0.13
209 0.13
210 0.1
211 0.09
212 0.08
213 0.05
214 0.06
215 0.06
216 0.06
217 0.07
218 0.07
219 0.08
220 0.1
221 0.11
222 0.14
223 0.17
224 0.18
225 0.17
226 0.18
227 0.19
228 0.2
229 0.2
230 0.17
231 0.15
232 0.14
233 0.17
234 0.16
235 0.14
236 0.1
237 0.1
238 0.09
239 0.1
240 0.1
241 0.06
242 0.06
243 0.07
244 0.09
245 0.1
246 0.1
247 0.1
248 0.1
249 0.11
250 0.1
251 0.11
252 0.09
253 0.08
254 0.08
255 0.07
256 0.07
257 0.07
258 0.07
259 0.06
260 0.06
261 0.07
262 0.07
263 0.09
264 0.09
265 0.09
266 0.1
267 0.11
268 0.1
269 0.1
270 0.1
271 0.08
272 0.07
273 0.07
274 0.06
275 0.05
276 0.05
277 0.04
278 0.04
279 0.05
280 0.05
281 0.05
282 0.04
283 0.04
284 0.04
285 0.04
286 0.05
287 0.05
288 0.05
289 0.05
290 0.07
291 0.07
292 0.08
293 0.09
294 0.12
295 0.15
296 0.15
297 0.15
298 0.16
299 0.16
300 0.15
301 0.15
302 0.12
303 0.09
304 0.1
305 0.09
306 0.08
307 0.08
308 0.08
309 0.07
310 0.08
311 0.1
312 0.15
313 0.16
314 0.2
315 0.26
316 0.32
317 0.35
318 0.38
319 0.35
320 0.37
321 0.47
322 0.45
323 0.41
324 0.38
325 0.35
326 0.32
327 0.33
328 0.28
329 0.18
330 0.16
331 0.15
332 0.16
333 0.15
334 0.15
335 0.15
336 0.17
337 0.17
338 0.19
339 0.21
340 0.19
341 0.21
342 0.25
343 0.25
344 0.23
345 0.25
346 0.27
347 0.27
348 0.26
349 0.33
350 0.34
351 0.4
352 0.46
353 0.44
354 0.4
355 0.37
356 0.38
357 0.33
358 0.29
359 0.23
360 0.19
361 0.2
362 0.24
363 0.29
364 0.29
365 0.26
366 0.25
367 0.25
368 0.22
369 0.19
370 0.15
371 0.1
372 0.11
373 0.13
374 0.13
375 0.12
376 0.13
377 0.14
378 0.14
379 0.17
380 0.18
381 0.2
382 0.21
383 0.22
384 0.21
385 0.22
386 0.23
387 0.19
388 0.16
389 0.11
390 0.1
391 0.1
392 0.1
393 0.08
394 0.07
395 0.08
396 0.08
397 0.11
398 0.12
399 0.11
400 0.13
401 0.13
402 0.15
403 0.14
404 0.13
405 0.1
406 0.1
407 0.09
408 0.07
409 0.07
410 0.05
411 0.05
412 0.05
413 0.05
414 0.04
415 0.06
416 0.06
417 0.06
418 0.07
419 0.08
420 0.08
421 0.11
422 0.13
423 0.11
424 0.12
425 0.12
426 0.12
427 0.13
428 0.13
429 0.11
430 0.11
431 0.11
432 0.12
433 0.12
434 0.12
435 0.11
436 0.1
437 0.1
438 0.1
439 0.11
440 0.12
441 0.11
442 0.11
443 0.11
444 0.13
445 0.13
446 0.17
447 0.22
448 0.25
449 0.28
450 0.31
451 0.4
452 0.47
453 0.51
454 0.5
455 0.45
456 0.41
457 0.39
458 0.41
459 0.35
460 0.28
461 0.23
462 0.19
463 0.2
464 0.21
465 0.2
466 0.14