Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K4N7

Protein Details
Accession B6K4N7    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
109-131DDSEQETFQRHKRKKRKANTNSTHydrophilic
NLS Segment(s)
PositionSequence
118-125RHKRKKRK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013246  SAGA_su_Sgf11  
Gene Ontology GO:0071819  C:DUBm complex  
GO:0000124  C:SAGA complex  
GO:0003713  F:transcription coactivator activity  
GO:0008270  F:zinc ion binding  
GO:0006325  P:chromatin organization  
GO:0016578  P:histone deubiquitination  
Pfam View protein in Pfam  
PF08209  Sgf11  
Amino Acid Sequences MHPQSLAGLSCSVLEQLLCDWVHELAQQFHRSAKLSLQECPACKSRCRQFCSRSGFDIFANSIQTPSTVPYYNCEGCGRQIAASRYAAHLEKCKGRTHSVTSFTEYNEDDSEQETFQRHKRKKRKANTNST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.11
5 0.11
6 0.11
7 0.11
8 0.11
9 0.12
10 0.13
11 0.15
12 0.15
13 0.2
14 0.22
15 0.22
16 0.24
17 0.26
18 0.26
19 0.25
20 0.24
21 0.26
22 0.26
23 0.28
24 0.33
25 0.34
26 0.33
27 0.36
28 0.39
29 0.33
30 0.34
31 0.39
32 0.42
33 0.47
34 0.52
35 0.57
36 0.56
37 0.62
38 0.68
39 0.62
40 0.57
41 0.5
42 0.46
43 0.37
44 0.32
45 0.25
46 0.17
47 0.15
48 0.12
49 0.1
50 0.08
51 0.08
52 0.07
53 0.08
54 0.09
55 0.09
56 0.1
57 0.12
58 0.17
59 0.17
60 0.19
61 0.19
62 0.17
63 0.16
64 0.2
65 0.18
66 0.14
67 0.18
68 0.18
69 0.2
70 0.21
71 0.2
72 0.18
73 0.2
74 0.2
75 0.17
76 0.21
77 0.22
78 0.27
79 0.29
80 0.34
81 0.34
82 0.38
83 0.41
84 0.43
85 0.46
86 0.46
87 0.46
88 0.45
89 0.43
90 0.39
91 0.37
92 0.31
93 0.26
94 0.22
95 0.2
96 0.16
97 0.16
98 0.17
99 0.14
100 0.15
101 0.16
102 0.19
103 0.26
104 0.36
105 0.43
106 0.52
107 0.63
108 0.73
109 0.81
110 0.88
111 0.92