Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3EW62

Protein Details
Accession A0A2H3EW62    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-49MQSPGCTYPKRKKMRRFRPFGTHydrophilic
NLS Segment(s)
PositionSequence
37-43KRKKMRR
Subcellular Location(s) mito 13, nucl 6, cyto 3, plas 3
Family & Domain DBs
Amino Acid Sequences MMPWQRSVSSGVQRIAALGSCLSFRFSMQSPGCTYPKRKKMRRFRPFGTSLPAPLSLLFELYPPLMPHLLDIQLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.28
3 0.22
4 0.14
5 0.09
6 0.09
7 0.08
8 0.08
9 0.09
10 0.08
11 0.08
12 0.11
13 0.11
14 0.2
15 0.2
16 0.22
17 0.24
18 0.28
19 0.31
20 0.31
21 0.36
22 0.37
23 0.46
24 0.53
25 0.59
26 0.65
27 0.73
28 0.82
29 0.85
30 0.85
31 0.79
32 0.78
33 0.75
34 0.67
35 0.62
36 0.52
37 0.43
38 0.37
39 0.33
40 0.24
41 0.19
42 0.19
43 0.12
44 0.12
45 0.11
46 0.09
47 0.09
48 0.1
49 0.11
50 0.09
51 0.12
52 0.12
53 0.12
54 0.13
55 0.15