Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K770

Protein Details
Accession B6K770    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
29-52GEGLTNRGQKRKKRAKTAYFGCVGHydrophilic
NLS Segment(s)
PositionSequence
37-43QKRKKRA
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039602  Rxt2  
IPR013904  RXT2_N  
Gene Ontology GO:1990483  C:Clr6 histone deacetylase complex I''  
GO:0005829  C:cytosol  
GO:0033698  C:Rpd3L complex  
GO:0016575  P:histone deacetylation  
GO:0061188  P:negative regulation of rDNA heterochromatin formation  
GO:0061186  P:negative regulation of silent mating-type cassette heterochromatin formation  
Pfam View protein in Pfam  
PF08595  RXT2_N  
Amino Acid Sequences MKQLEEQIERFKEVLFENSNASDSDSSIGEGLTNRGQKRKKRAKTAYFGCVGRSAGSGLDVDVYSIGDSKRSVISHYQKRKEPEWLDRDNPYRDINVSELVLPLSKPAQLLDNPDTMSIFKNDVLSQLAETAQQSIVNEHKYTVQLQQLFIALLGDDPNLTVSPNERFGITDEQRSTLLDIVRESLDKSREFVRSLTTIRMNLLRAERYKNKVLSYCRGGEETSEKEQDGNRENESNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.26
3 0.25
4 0.26
5 0.27
6 0.27
7 0.24
8 0.25
9 0.18
10 0.15
11 0.15
12 0.13
13 0.12
14 0.11
15 0.11
16 0.09
17 0.09
18 0.12
19 0.16
20 0.21
21 0.23
22 0.31
23 0.39
24 0.47
25 0.57
26 0.66
27 0.7
28 0.75
29 0.83
30 0.85
31 0.88
32 0.87
33 0.83
34 0.77
35 0.68
36 0.58
37 0.5
38 0.41
39 0.31
40 0.24
41 0.18
42 0.12
43 0.12
44 0.1
45 0.08
46 0.08
47 0.07
48 0.07
49 0.06
50 0.06
51 0.05
52 0.07
53 0.07
54 0.07
55 0.07
56 0.09
57 0.11
58 0.12
59 0.14
60 0.21
61 0.31
62 0.4
63 0.5
64 0.55
65 0.57
66 0.62
67 0.62
68 0.63
69 0.59
70 0.58
71 0.56
72 0.55
73 0.53
74 0.54
75 0.56
76 0.49
77 0.46
78 0.38
79 0.31
80 0.26
81 0.24
82 0.2
83 0.16
84 0.13
85 0.11
86 0.1
87 0.09
88 0.09
89 0.07
90 0.07
91 0.06
92 0.06
93 0.06
94 0.06
95 0.08
96 0.09
97 0.14
98 0.16
99 0.17
100 0.17
101 0.16
102 0.16
103 0.14
104 0.14
105 0.1
106 0.09
107 0.08
108 0.09
109 0.09
110 0.1
111 0.1
112 0.09
113 0.09
114 0.08
115 0.08
116 0.07
117 0.07
118 0.07
119 0.06
120 0.07
121 0.07
122 0.08
123 0.1
124 0.12
125 0.12
126 0.11
127 0.13
128 0.13
129 0.15
130 0.16
131 0.19
132 0.18
133 0.18
134 0.19
135 0.18
136 0.16
137 0.15
138 0.11
139 0.06
140 0.05
141 0.05
142 0.04
143 0.04
144 0.04
145 0.05
146 0.05
147 0.05
148 0.05
149 0.07
150 0.09
151 0.12
152 0.13
153 0.12
154 0.13
155 0.16
156 0.25
157 0.25
158 0.28
159 0.27
160 0.28
161 0.28
162 0.28
163 0.26
164 0.2
165 0.19
166 0.14
167 0.14
168 0.14
169 0.15
170 0.15
171 0.15
172 0.16
173 0.19
174 0.18
175 0.2
176 0.23
177 0.25
178 0.26
179 0.26
180 0.26
181 0.27
182 0.28
183 0.32
184 0.31
185 0.29
186 0.29
187 0.32
188 0.28
189 0.28
190 0.3
191 0.31
192 0.31
193 0.39
194 0.44
195 0.47
196 0.54
197 0.53
198 0.54
199 0.55
200 0.58
201 0.58
202 0.57
203 0.55
204 0.49
205 0.47
206 0.42
207 0.39
208 0.38
209 0.35
210 0.35
211 0.33
212 0.3
213 0.31
214 0.34
215 0.37
216 0.39
217 0.37
218 0.35