Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B6K667

Protein Details
Accession B6K667   
Localization Confidence High
Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
6-37MKKNSTFAAKKQRQTKKAKNPKKGARFCAPKRHydrophilic
NLS Segment(s)
PositionSequence
14-37AKKQRQTKKAKNPKKGARFCAPKR
90-92KKR
Subcellular Location(s) nucl 17, cyto 6, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019034  UPF0390  
Pfam View protein in Pfam  
PF09495  DUF2462  
Amino Acid Sequences MAQGEMKKNSTFAAKKQRQTKKAKNPKKGARFCAPKRPAAVKDHLVNKAFTKALNVKNEKMFAGVAKQQSDKLTIMKALSEAGAKELDKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.56
3 0.65
4 0.74
5 0.75
6 0.82
7 0.84
8 0.84
9 0.87
10 0.9
11 0.9
12 0.91
13 0.91
14 0.91
15 0.89
16 0.84
17 0.83
18 0.83
19 0.77
20 0.78
21 0.71
22 0.63
23 0.6
24 0.59
25 0.53
26 0.47
27 0.47
28 0.4
29 0.42
30 0.43
31 0.43
32 0.38
33 0.34
34 0.3
35 0.27
36 0.23
37 0.18
38 0.18
39 0.2
40 0.25
41 0.33
42 0.36
43 0.36
44 0.38
45 0.39
46 0.35
47 0.3
48 0.24
49 0.16
50 0.17
51 0.19
52 0.19
53 0.2
54 0.21
55 0.22
56 0.23
57 0.26
58 0.23
59 0.2
60 0.19
61 0.19
62 0.19
63 0.17
64 0.16
65 0.14
66 0.13
67 0.13
68 0.11
69 0.11
70 0.13
71 0.13
72 0.21