Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K4F9

Protein Details
Accession B6K4F9    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
38-61SPELRKKYEKAKRNSQKEAQKVQEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, mito_nucl 12.166, nucl 10, cyto_mito 8.666, cyto_nucl 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR012420  Cbp4  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF07960  CBP4  
Amino Acid Sequences MSNKWTKAFLYSGLIIGTGYGLLKYTTPTPEQVKESLSPELRKKYEKAKRNSQKEAQKVQECIDAAKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.15
3 0.13
4 0.1
5 0.05
6 0.05
7 0.04
8 0.04
9 0.04
10 0.05
11 0.06
12 0.08
13 0.1
14 0.11
15 0.15
16 0.18
17 0.21
18 0.23
19 0.23
20 0.23
21 0.22
22 0.23
23 0.24
24 0.23
25 0.24
26 0.26
27 0.32
28 0.33
29 0.34
30 0.35
31 0.41
32 0.48
33 0.53
34 0.57
35 0.62
36 0.7
37 0.76
38 0.82
39 0.8
40 0.81
41 0.81
42 0.82
43 0.79
44 0.75
45 0.68
46 0.62
47 0.58
48 0.49
49 0.41