Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JYY8

Protein Details
Accession B6JYY8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
10-31AIRKHGRRFDYEEKKRKKAAREBasic
40-70QKVRGIKAKLYQEKRRKEKIQMKKTIKEHDEBasic
NLS Segment(s)
PositionSequence
13-63KHGRRFDYEEKKRKKAAREVHESSKYAQKVRGIKAKLYQEKRRKEKIQMKK
Subcellular Location(s) nucl 19.5, cyto_nucl 13.833, mito_nucl 11.166, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR039411  NSA2_fam  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0000460  P:maturation of 5.8S rRNA  
GO:0000466  P:maturation of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000470  P:maturation of LSU-rRNA  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11381  NSA2  
Amino Acid Sequences MPQNEYIEEAIRKHGRRFDYEEKKRKKAAREVHESSKYAQKVRGIKAKLYQEKRRKEKIQMKKTIKEHDERNTTQRGSEPEVQGAVPTYLLDREQESQAKMLSNAVKQKRKEKAAKFSVPLPQVRGVSEEEMFKVVRTGKSKKNAWKRMITKATFVGDGFTRRPVKYERFIRPMALRQKKANVTHRELGVTMQLPIIGVKKNPQSPMYTQLGVLTKGTIIEVNVSELGLVTAGGKVVWGKYAQVTNNPELDGCVNALLLT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.5
4 0.57
5 0.6
6 0.64
7 0.71
8 0.77
9 0.79
10 0.82
11 0.84
12 0.81
13 0.8
14 0.79
15 0.78
16 0.78
17 0.79
18 0.78
19 0.79
20 0.78
21 0.71
22 0.63
23 0.61
24 0.54
25 0.48
26 0.44
27 0.42
28 0.43
29 0.49
30 0.55
31 0.5
32 0.5
33 0.55
34 0.61
35 0.64
36 0.65
37 0.68
38 0.69
39 0.77
40 0.82
41 0.84
42 0.8
43 0.81
44 0.83
45 0.83
46 0.84
47 0.85
48 0.84
49 0.82
50 0.83
51 0.81
52 0.76
53 0.71
54 0.67
55 0.66
56 0.66
57 0.6
58 0.59
59 0.55
60 0.5
61 0.45
62 0.42
63 0.37
64 0.35
65 0.38
66 0.34
67 0.29
68 0.29
69 0.28
70 0.24
71 0.21
72 0.15
73 0.08
74 0.07
75 0.06
76 0.06
77 0.06
78 0.07
79 0.08
80 0.1
81 0.13
82 0.15
83 0.15
84 0.16
85 0.16
86 0.16
87 0.15
88 0.16
89 0.16
90 0.17
91 0.24
92 0.31
93 0.37
94 0.39
95 0.48
96 0.51
97 0.57
98 0.63
99 0.63
100 0.66
101 0.68
102 0.7
103 0.63
104 0.59
105 0.57
106 0.51
107 0.44
108 0.36
109 0.3
110 0.26
111 0.24
112 0.23
113 0.18
114 0.16
115 0.16
116 0.13
117 0.11
118 0.11
119 0.11
120 0.09
121 0.1
122 0.1
123 0.13
124 0.18
125 0.23
126 0.28
127 0.36
128 0.43
129 0.5
130 0.59
131 0.64
132 0.65
133 0.69
134 0.67
135 0.69
136 0.71
137 0.63
138 0.55
139 0.49
140 0.45
141 0.36
142 0.31
143 0.22
144 0.15
145 0.17
146 0.15
147 0.18
148 0.2
149 0.2
150 0.23
151 0.26
152 0.31
153 0.38
154 0.46
155 0.47
156 0.5
157 0.51
158 0.52
159 0.5
160 0.53
161 0.54
162 0.54
163 0.5
164 0.48
165 0.54
166 0.58
167 0.62
168 0.63
169 0.61
170 0.59
171 0.6
172 0.57
173 0.51
174 0.44
175 0.37
176 0.31
177 0.23
178 0.16
179 0.12
180 0.11
181 0.09
182 0.1
183 0.11
184 0.1
185 0.1
186 0.15
187 0.22
188 0.26
189 0.29
190 0.31
191 0.34
192 0.35
193 0.41
194 0.41
195 0.35
196 0.31
197 0.32
198 0.32
199 0.28
200 0.25
201 0.18
202 0.13
203 0.13
204 0.13
205 0.09
206 0.07
207 0.09
208 0.09
209 0.11
210 0.11
211 0.1
212 0.1
213 0.09
214 0.09
215 0.06
216 0.06
217 0.04
218 0.04
219 0.05
220 0.04
221 0.05
222 0.06
223 0.06
224 0.09
225 0.09
226 0.1
227 0.14
228 0.2
229 0.23
230 0.3
231 0.35
232 0.37
233 0.39
234 0.38
235 0.33
236 0.3
237 0.28
238 0.22
239 0.16
240 0.13