Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6K5G6

Protein Details
Accession B6K5G6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
15-39KVPKDTMKSVDKKRGKNRKETYSSYHydrophilic
NLS Segment(s)
PositionSequence
5-33KKPASKAPAGKVPKDTMKSVDKKRGKNRK
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0035861  C:site of double-strand break  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
GO:0006325  P:chromatin organization  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MSAEKKPASKAPAGKVPKDTMKSVDKKRGKNRKETYSSYIYKVLKQVHPDTGISNQAMRILNSFVNDIFERIATEASKLAAYNKKSTISSREIQTAVRLILPGELAKHAVTEGTKSVTKYSSSAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.56
3 0.57
4 0.57
5 0.54
6 0.49
7 0.45
8 0.49
9 0.54
10 0.57
11 0.62
12 0.62
13 0.68
14 0.76
15 0.81
16 0.78
17 0.8
18 0.81
19 0.81
20 0.8
21 0.77
22 0.72
23 0.7
24 0.66
25 0.58
26 0.56
27 0.47
28 0.41
29 0.4
30 0.39
31 0.33
32 0.36
33 0.36
34 0.33
35 0.34
36 0.32
37 0.28
38 0.25
39 0.24
40 0.19
41 0.17
42 0.13
43 0.15
44 0.15
45 0.13
46 0.12
47 0.11
48 0.12
49 0.12
50 0.12
51 0.08
52 0.1
53 0.1
54 0.09
55 0.08
56 0.07
57 0.07
58 0.07
59 0.08
60 0.06
61 0.07
62 0.07
63 0.07
64 0.07
65 0.07
66 0.11
67 0.16
68 0.18
69 0.22
70 0.24
71 0.25
72 0.26
73 0.29
74 0.31
75 0.31
76 0.33
77 0.32
78 0.34
79 0.32
80 0.31
81 0.31
82 0.27
83 0.22
84 0.18
85 0.15
86 0.11
87 0.11
88 0.12
89 0.1
90 0.09
91 0.09
92 0.1
93 0.1
94 0.1
95 0.09
96 0.1
97 0.1
98 0.11
99 0.13
100 0.16
101 0.18
102 0.19
103 0.22
104 0.22
105 0.24