Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3EC10

Protein Details
Accession A0A2H3EC10   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
301-328DPRITPRVKIPRYVKKPKEKIQVVSRSSHydrophilic
345-369RSLLKRYKASERRSAKRREKRGLTSBasic
NLS Segment(s)
PositionSequence
349-366KRYKASERRSAKRREKRG
Subcellular Location(s) mito 14, mito_nucl 13.166, nucl 11, cyto_mito 8.666, cyto_nucl 7.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR021036  Ribosomal_S35_mit  
Pfam View protein in Pfam  
PF12298  Bot1p  
Amino Acid Sequences MLNLYRHLTFRCARPSLVHARPSLRHNLSSSAIRFVDDVGGSGSTPDSAETVKKLTDVEEDADLSSISEEERLMLEAEEEGTQSEDALAEQSEEAAETVTEEADEFEGESEEDERQSGQPKSYAAFMEKIGGRFKVANEAKWLGGDIPFPMNRSFKPPPPLSDSHRSIIYEEYMRDPEKNNVRELAQRHHLSLGRVDAILRLKGMEHAWVKGKTLQTGFRIGMEKLVSVRDSRRRITSREDANEADEIEEEPGRQAARDRYERHYWESLLEDAESVVPRSLKHSKALATMKTASDYLHTDDPRITPRVKIPRYVKKPKEKIQVVSRSSRPDLKFVDVGSKFIDQRSLLKRYKASERRSAKRREKRGLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.52
4 0.55
5 0.54
6 0.49
7 0.53
8 0.56
9 0.57
10 0.6
11 0.54
12 0.5
13 0.47
14 0.47
15 0.44
16 0.47
17 0.44
18 0.39
19 0.35
20 0.31
21 0.29
22 0.25
23 0.25
24 0.18
25 0.17
26 0.12
27 0.12
28 0.11
29 0.12
30 0.11
31 0.08
32 0.08
33 0.07
34 0.07
35 0.08
36 0.1
37 0.12
38 0.14
39 0.14
40 0.15
41 0.15
42 0.15
43 0.18
44 0.18
45 0.18
46 0.18
47 0.18
48 0.17
49 0.17
50 0.15
51 0.12
52 0.09
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.07
60 0.08
61 0.08
62 0.08
63 0.07
64 0.09
65 0.08
66 0.07
67 0.07
68 0.07
69 0.07
70 0.07
71 0.06
72 0.05
73 0.05
74 0.06
75 0.06
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.04
84 0.04
85 0.05
86 0.05
87 0.05
88 0.04
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.05
95 0.05
96 0.06
97 0.06
98 0.07
99 0.07
100 0.07
101 0.08
102 0.09
103 0.15
104 0.15
105 0.16
106 0.17
107 0.18
108 0.19
109 0.2
110 0.2
111 0.17
112 0.17
113 0.16
114 0.19
115 0.19
116 0.2
117 0.2
118 0.18
119 0.18
120 0.17
121 0.17
122 0.23
123 0.22
124 0.22
125 0.25
126 0.26
127 0.25
128 0.23
129 0.24
130 0.14
131 0.13
132 0.12
133 0.09
134 0.1
135 0.11
136 0.12
137 0.14
138 0.16
139 0.15
140 0.23
141 0.26
142 0.27
143 0.35
144 0.35
145 0.37
146 0.42
147 0.45
148 0.43
149 0.49
150 0.47
151 0.41
152 0.4
153 0.37
154 0.31
155 0.28
156 0.23
157 0.17
158 0.14
159 0.14
160 0.15
161 0.15
162 0.16
163 0.16
164 0.2
165 0.27
166 0.28
167 0.27
168 0.26
169 0.27
170 0.3
171 0.31
172 0.3
173 0.29
174 0.28
175 0.27
176 0.29
177 0.29
178 0.25
179 0.24
180 0.21
181 0.14
182 0.13
183 0.13
184 0.12
185 0.12
186 0.11
187 0.1
188 0.08
189 0.08
190 0.09
191 0.1
192 0.13
193 0.12
194 0.14
195 0.19
196 0.19
197 0.2
198 0.23
199 0.23
200 0.21
201 0.22
202 0.25
203 0.22
204 0.25
205 0.24
206 0.23
207 0.24
208 0.21
209 0.21
210 0.17
211 0.16
212 0.13
213 0.14
214 0.12
215 0.12
216 0.18
217 0.23
218 0.28
219 0.3
220 0.37
221 0.4
222 0.42
223 0.48
224 0.51
225 0.51
226 0.51
227 0.51
228 0.44
229 0.42
230 0.4
231 0.32
232 0.24
233 0.16
234 0.12
235 0.1
236 0.09
237 0.08
238 0.07
239 0.08
240 0.08
241 0.08
242 0.11
243 0.15
244 0.23
245 0.3
246 0.34
247 0.39
248 0.47
249 0.5
250 0.52
251 0.5
252 0.43
253 0.38
254 0.36
255 0.31
256 0.24
257 0.21
258 0.15
259 0.11
260 0.12
261 0.11
262 0.09
263 0.1
264 0.09
265 0.1
266 0.16
267 0.22
268 0.23
269 0.26
270 0.29
271 0.3
272 0.38
273 0.44
274 0.4
275 0.38
276 0.39
277 0.36
278 0.33
279 0.31
280 0.23
281 0.2
282 0.2
283 0.19
284 0.23
285 0.23
286 0.22
287 0.24
288 0.27
289 0.29
290 0.31
291 0.28
292 0.25
293 0.33
294 0.43
295 0.44
296 0.5
297 0.55
298 0.62
299 0.72
300 0.79
301 0.8
302 0.81
303 0.88
304 0.89
305 0.9
306 0.86
307 0.84
308 0.83
309 0.84
310 0.78
311 0.76
312 0.71
313 0.67
314 0.64
315 0.64
316 0.55
317 0.52
318 0.5
319 0.48
320 0.45
321 0.39
322 0.45
323 0.37
324 0.37
325 0.33
326 0.33
327 0.29
328 0.27
329 0.31
330 0.22
331 0.3
332 0.36
333 0.42
334 0.42
335 0.48
336 0.52
337 0.53
338 0.63
339 0.64
340 0.64
341 0.66
342 0.71
343 0.75
344 0.8
345 0.85
346 0.85
347 0.86
348 0.89
349 0.9