Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3CVE0

Protein Details
Accession A0A2H3CVE0    Localization Confidence Low Confidence Score 6.4
NoLS Segment(s)
PositionSequenceProtein Nature
49-77QPNNHKTSGKKCKCNKCKAERCKGCTNPAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 12.833, nucl 6, cyto_nucl 4.333
Family & Domain DBs
Amino Acid Sequences EGKGKMPLWYHNASSAKTNRITNSKQGKCLRENHKIYTVGDAINITANQPNNHKTSGKKCKCNKCKAERCKGCTNPAKCLLIVKKLLNELPTHWRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.41
3 0.4
4 0.4
5 0.42
6 0.38
7 0.43
8 0.46
9 0.48
10 0.54
11 0.52
12 0.57
13 0.61
14 0.62
15 0.6
16 0.65
17 0.64
18 0.63
19 0.64
20 0.59
21 0.58
22 0.55
23 0.5
24 0.45
25 0.37
26 0.27
27 0.23
28 0.19
29 0.12
30 0.11
31 0.1
32 0.07
33 0.08
34 0.09
35 0.1
36 0.12
37 0.15
38 0.16
39 0.18
40 0.2
41 0.22
42 0.32
43 0.42
44 0.47
45 0.54
46 0.62
47 0.71
48 0.79
49 0.85
50 0.85
51 0.85
52 0.88
53 0.88
54 0.91
55 0.89
56 0.86
57 0.85
58 0.8
59 0.79
60 0.77
61 0.71
62 0.67
63 0.64
64 0.6
65 0.49
66 0.52
67 0.47
68 0.45
69 0.46
70 0.41
71 0.38
72 0.4
73 0.43
74 0.36
75 0.34
76 0.31