Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2H3DVL3

Protein Details
Accession A0A2H3DVL3    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
7-34RAENSTSYSQRRRCKSRRRTMGMERPEYHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, mito 5, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045338  DUF6535  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF20153  DUF6535  
Amino Acid Sequences MIDDGPRAENSTSYSQRRRCKSRRRTMGMERPEYVVKGSDPFDYEQKFPEDKQQEEMGPTARVWRTYLEESAPFDIEMVEGWRDGLDVLLIFAGLFSAVVTTFVAQTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.6
4 0.69
5 0.74
6 0.76
7 0.8
8 0.84
9 0.86
10 0.89
11 0.88
12 0.88
13 0.88
14 0.88
15 0.86
16 0.79
17 0.69
18 0.61
19 0.54
20 0.45
21 0.35
22 0.26
23 0.17
24 0.15
25 0.15
26 0.13
27 0.13
28 0.14
29 0.18
30 0.18
31 0.18
32 0.18
33 0.21
34 0.21
35 0.19
36 0.27
37 0.27
38 0.25
39 0.28
40 0.28
41 0.25
42 0.25
43 0.25
44 0.18
45 0.14
46 0.13
47 0.15
48 0.13
49 0.13
50 0.13
51 0.14
52 0.17
53 0.18
54 0.2
55 0.17
56 0.19
57 0.2
58 0.21
59 0.2
60 0.15
61 0.13
62 0.11
63 0.09
64 0.08
65 0.08
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.03
81 0.03
82 0.03
83 0.02
84 0.03
85 0.03
86 0.04
87 0.05
88 0.06