Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JWC9

Protein Details
Accession B6JWC9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-39QTIKSFSRRFSKRTKPERKPKFVQPTPPPHydrophilic
NLS Segment(s)
PositionSequence
18-31RRFSKRTKPERKPK
Subcellular Location(s) nucl 11.5, cyto_nucl 10, mito 8, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012875  SDHF4  
Pfam View protein in Pfam  
PF07896  DUF1674  
Amino Acid Sequences MFKKLQSSARQTIKSFSRRFSKRTKPERKPKFVQPTPPPLNKKAQYDWIQQQREAAKRPVDVVHRPKQETFEGNQNPETGEINGPKEDPLKHGDYSFGGRVTDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.58
3 0.55
4 0.57
5 0.57
6 0.61
7 0.65
8 0.67
9 0.68
10 0.76
11 0.81
12 0.81
13 0.87
14 0.93
15 0.92
16 0.87
17 0.87
18 0.87
19 0.81
20 0.8
21 0.76
22 0.76
23 0.74
24 0.75
25 0.69
26 0.62
27 0.65
28 0.59
29 0.56
30 0.48
31 0.49
32 0.46
33 0.48
34 0.52
35 0.52
36 0.49
37 0.44
38 0.45
39 0.42
40 0.4
41 0.38
42 0.34
43 0.27
44 0.26
45 0.27
46 0.27
47 0.27
48 0.32
49 0.37
50 0.41
51 0.45
52 0.46
53 0.46
54 0.46
55 0.44
56 0.4
57 0.34
58 0.36
59 0.35
60 0.35
61 0.35
62 0.32
63 0.29
64 0.27
65 0.26
66 0.17
67 0.16
68 0.17
69 0.18
70 0.19
71 0.18
72 0.19
73 0.21
74 0.2
75 0.2
76 0.23
77 0.24
78 0.25
79 0.25
80 0.26
81 0.25
82 0.29
83 0.29
84 0.25