Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DH80

Protein Details
Accession A0A2H3DH80   
Localization Confidence High
Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
52-77HEEPPSPPKKVLKRKRAPSKTIPSEPBasic
106-134RPSVKKPRFSPKKASKKKSSRKTTKSAISHydrophilic
NLS Segment(s)
PositionSequence
19-27KKKAKGKGK
58-82PPKKVLKRKRAPSKTIPSEPGPSKP
108-128SVKKPRFSPKKASKKKSSRKT
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MDVDAPPSPPRVYHLVTEKKKAKGKGKAVVLSPEPSPPVAATSANITTSLSHEEPPSPPKKVLKRKRAPSKTIPSEPGPSKPTRARVATPAAAVIPSDAEASDIIRPSVKKPRFSPKKASKKKSSRKTTKSAISDAPPDSNRMFLGHPKQQYLAAELTQAQDPGQEGIPIDRHNSCAELENYRFEDLVTAPNEFFDSLLQHPAAPQYQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.46
3 0.51
4 0.6
5 0.63
6 0.65
7 0.69
8 0.72
9 0.71
10 0.71
11 0.75
12 0.73
13 0.75
14 0.71
15 0.67
16 0.65
17 0.58
18 0.5
19 0.42
20 0.35
21 0.28
22 0.23
23 0.21
24 0.15
25 0.14
26 0.13
27 0.13
28 0.11
29 0.14
30 0.15
31 0.14
32 0.14
33 0.12
34 0.11
35 0.13
36 0.17
37 0.14
38 0.15
39 0.15
40 0.17
41 0.2
42 0.27
43 0.3
44 0.28
45 0.3
46 0.37
47 0.46
48 0.55
49 0.63
50 0.67
51 0.73
52 0.8
53 0.88
54 0.89
55 0.86
56 0.85
57 0.86
58 0.83
59 0.78
60 0.71
61 0.63
62 0.6
63 0.55
64 0.5
65 0.43
66 0.36
67 0.36
68 0.36
69 0.39
70 0.37
71 0.38
72 0.35
73 0.36
74 0.39
75 0.35
76 0.31
77 0.26
78 0.2
79 0.17
80 0.15
81 0.1
82 0.05
83 0.04
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.06
90 0.06
91 0.06
92 0.07
93 0.08
94 0.11
95 0.21
96 0.24
97 0.28
98 0.33
99 0.44
100 0.53
101 0.58
102 0.66
103 0.67
104 0.74
105 0.79
106 0.83
107 0.83
108 0.84
109 0.89
110 0.89
111 0.89
112 0.88
113 0.86
114 0.85
115 0.82
116 0.79
117 0.72
118 0.65
119 0.58
120 0.49
121 0.46
122 0.4
123 0.36
124 0.28
125 0.27
126 0.24
127 0.21
128 0.19
129 0.16
130 0.16
131 0.18
132 0.25
133 0.28
134 0.3
135 0.31
136 0.31
137 0.32
138 0.31
139 0.28
140 0.23
141 0.17
142 0.16
143 0.16
144 0.16
145 0.15
146 0.14
147 0.1
148 0.09
149 0.1
150 0.1
151 0.1
152 0.09
153 0.09
154 0.11
155 0.14
156 0.14
157 0.17
158 0.16
159 0.17
160 0.18
161 0.19
162 0.17
163 0.2
164 0.22
165 0.25
166 0.26
167 0.29
168 0.31
169 0.3
170 0.29
171 0.23
172 0.23
173 0.17
174 0.22
175 0.18
176 0.18
177 0.17
178 0.17
179 0.18
180 0.16
181 0.16
182 0.11
183 0.13
184 0.12
185 0.17
186 0.17
187 0.16
188 0.17
189 0.21