Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3DFG1

Protein Details
Accession A0A2H3DFG1    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
9-36DDSRRLSLKPSKYKTLRRRYHPYSRPDSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 10, cyto 6.5, plas 6
Family & Domain DBs
Amino Acid Sequences MGYAPSPYDDSRRLSLKPSKYKTLRRRYHPYSRPDSVLFKPQNPLSPSNEIAHEDVIKEVVEAVDGPSCRWKKVLAALAALAIFLRIIENICRCGAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.49
4 0.56
5 0.57
6 0.63
7 0.68
8 0.77
9 0.8
10 0.83
11 0.82
12 0.8
13 0.84
14 0.83
15 0.85
16 0.82
17 0.8
18 0.77
19 0.71
20 0.66
21 0.59
22 0.55
23 0.46
24 0.48
25 0.41
26 0.35
27 0.35
28 0.33
29 0.36
30 0.34
31 0.35
32 0.29
33 0.31
34 0.31
35 0.28
36 0.28
37 0.23
38 0.21
39 0.18
40 0.14
41 0.11
42 0.09
43 0.08
44 0.07
45 0.06
46 0.05
47 0.04
48 0.04
49 0.04
50 0.05
51 0.07
52 0.07
53 0.08
54 0.16
55 0.18
56 0.18
57 0.19
58 0.19
59 0.2
60 0.28
61 0.35
62 0.29
63 0.29
64 0.29
65 0.29
66 0.28
67 0.24
68 0.16
69 0.08
70 0.06
71 0.04
72 0.05
73 0.04
74 0.06
75 0.11
76 0.14
77 0.16