Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2H3EJG6

Protein Details
Accession A0A2H3EJG6   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
143-164AERRKRWPSDHRVQEKKRKQEEBasic
NLS Segment(s)
PositionSequence
146-150RKRWP
153-161HRVQEKKRK
181-223RKRQRTAGNEPRPPNRGRQRGRGHVRGAADSGWRGRGRGRGGA
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039136  NUFIP1-like  
IPR019496  NUFIP1_cons_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF10453  NUFIP1  
Amino Acid Sequences MANNSPYNNAAAAIQSSLSNPYAQAYSSHYAQAYSTTPQGYAVSSTYTAASSSSSSRPMNVGASSWYQTGNSRCTYKSCTFTGSQKSVETHMMDRHLIFPPGWDKQKKTDNWDADPSLKGKSVPIQGTTLVLDSPEVLDSWLAERRKRWPSDHRVQEKKRKQEEAIARGQLSVEELGLFSRKRQRTAGNEPRPPNRGRQRGRGHVRGAADSGWRGRGRGRGGAHPAPVQPRVETDSSSSDSNSSDNGEPEVLSSKVTSSPAVDHPPALPSKNIVPISRPPPRKPLQPTRPSQPTLLRNLLLPEIRMTVSNLSQAIRFLVQNDFLRNVELKPGEADEKMIQVIGTDEVHPQEQLSTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.11
4 0.14
5 0.14
6 0.13
7 0.12
8 0.13
9 0.14
10 0.14
11 0.14
12 0.18
13 0.21
14 0.22
15 0.24
16 0.22
17 0.22
18 0.22
19 0.23
20 0.19
21 0.18
22 0.2
23 0.18
24 0.18
25 0.19
26 0.19
27 0.17
28 0.16
29 0.14
30 0.14
31 0.13
32 0.14
33 0.13
34 0.13
35 0.12
36 0.1
37 0.11
38 0.1
39 0.13
40 0.15
41 0.19
42 0.19
43 0.21
44 0.22
45 0.22
46 0.23
47 0.2
48 0.19
49 0.16
50 0.19
51 0.2
52 0.19
53 0.18
54 0.16
55 0.2
56 0.23
57 0.25
58 0.25
59 0.27
60 0.27
61 0.31
62 0.37
63 0.38
64 0.39
65 0.36
66 0.37
67 0.37
68 0.43
69 0.47
70 0.44
71 0.4
72 0.38
73 0.38
74 0.36
75 0.36
76 0.31
77 0.26
78 0.25
79 0.26
80 0.24
81 0.23
82 0.24
83 0.22
84 0.21
85 0.18
86 0.18
87 0.2
88 0.25
89 0.32
90 0.32
91 0.33
92 0.4
93 0.49
94 0.49
95 0.53
96 0.56
97 0.54
98 0.55
99 0.58
100 0.52
101 0.46
102 0.44
103 0.37
104 0.29
105 0.25
106 0.2
107 0.16
108 0.19
109 0.23
110 0.23
111 0.23
112 0.23
113 0.22
114 0.23
115 0.22
116 0.17
117 0.11
118 0.09
119 0.07
120 0.06
121 0.06
122 0.05
123 0.05
124 0.04
125 0.04
126 0.05
127 0.07
128 0.12
129 0.13
130 0.14
131 0.16
132 0.24
133 0.32
134 0.36
135 0.41
136 0.46
137 0.54
138 0.63
139 0.71
140 0.73
141 0.75
142 0.8
143 0.84
144 0.82
145 0.82
146 0.79
147 0.73
148 0.65
149 0.63
150 0.64
151 0.59
152 0.57
153 0.48
154 0.42
155 0.37
156 0.36
157 0.26
158 0.19
159 0.12
160 0.06
161 0.04
162 0.04
163 0.04
164 0.06
165 0.06
166 0.08
167 0.17
168 0.18
169 0.21
170 0.24
171 0.3
172 0.36
173 0.47
174 0.56
175 0.57
176 0.62
177 0.64
178 0.65
179 0.64
180 0.57
181 0.56
182 0.54
183 0.55
184 0.53
185 0.59
186 0.63
187 0.68
188 0.74
189 0.71
190 0.64
191 0.58
192 0.54
193 0.45
194 0.38
195 0.28
196 0.22
197 0.16
198 0.15
199 0.16
200 0.14
201 0.14
202 0.15
203 0.2
204 0.21
205 0.26
206 0.28
207 0.29
208 0.35
209 0.38
210 0.37
211 0.34
212 0.34
213 0.31
214 0.32
215 0.27
216 0.2
217 0.2
218 0.22
219 0.2
220 0.19
221 0.18
222 0.19
223 0.2
224 0.2
225 0.19
226 0.16
227 0.15
228 0.15
229 0.13
230 0.13
231 0.12
232 0.12
233 0.12
234 0.12
235 0.11
236 0.12
237 0.14
238 0.11
239 0.1
240 0.09
241 0.09
242 0.11
243 0.12
244 0.12
245 0.11
246 0.14
247 0.17
248 0.22
249 0.22
250 0.21
251 0.2
252 0.23
253 0.24
254 0.23
255 0.19
256 0.16
257 0.19
258 0.26
259 0.28
260 0.25
261 0.27
262 0.33
263 0.41
264 0.48
265 0.52
266 0.48
267 0.55
268 0.59
269 0.65
270 0.67
271 0.7
272 0.72
273 0.75
274 0.77
275 0.77
276 0.8
277 0.73
278 0.68
279 0.66
280 0.61
281 0.59
282 0.58
283 0.49
284 0.41
285 0.41
286 0.4
287 0.33
288 0.27
289 0.21
290 0.18
291 0.18
292 0.18
293 0.18
294 0.17
295 0.17
296 0.19
297 0.18
298 0.17
299 0.17
300 0.17
301 0.17
302 0.16
303 0.15
304 0.14
305 0.16
306 0.21
307 0.24
308 0.26
309 0.27
310 0.25
311 0.28
312 0.27
313 0.25
314 0.26
315 0.24
316 0.22
317 0.21
318 0.24
319 0.24
320 0.23
321 0.26
322 0.2
323 0.21
324 0.2
325 0.18
326 0.15
327 0.12
328 0.13
329 0.12
330 0.12
331 0.11
332 0.13
333 0.15
334 0.16
335 0.16
336 0.15