Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B6JY61

Protein Details
Accession B6JY61    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-40KWAIGSVRWKMKRRSNRPAATDDHydrophilic
179-200DIPLRERKPLKRDLNKIPIPKSHydrophilic
NLS Segment(s)
PositionSequence
29-31KRR
Subcellular Location(s) mito 12.5, nucl 10, cyto_mito 8.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR039848  Ribosomal_S24/S35  
IPR019349  Ribosomal_S24/S35_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF10213  MRP-S28  
Amino Acid Sequences MLLRSNFTPLRTLDFTTKWAIGSVRWKMKRRSNRPAATDDTEKRRKMKESAIQELDNERFVREYYRKIAYELPFLSKFVKPFSKQNDAFLRFAYTARTKPTADDNKVSLTFHPDAIPSLDQPTIHALKLIADDRYDSSTGILTISCDTFPTALQNKRSLAVTFNKLIDKAREYKIKFADIPLRERKPLKRDLNKIPIPKSWFQKLYNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.34
3 0.34
4 0.34
5 0.27
6 0.26
7 0.23
8 0.22
9 0.29
10 0.34
11 0.4
12 0.48
13 0.55
14 0.61
15 0.71
16 0.78
17 0.79
18 0.82
19 0.82
20 0.83
21 0.81
22 0.78
23 0.75
24 0.69
25 0.68
26 0.63
27 0.61
28 0.61
29 0.59
30 0.57
31 0.56
32 0.55
33 0.52
34 0.55
35 0.54
36 0.55
37 0.61
38 0.61
39 0.56
40 0.52
41 0.51
42 0.43
43 0.37
44 0.29
45 0.2
46 0.16
47 0.15
48 0.21
49 0.19
50 0.23
51 0.24
52 0.29
53 0.3
54 0.31
55 0.37
56 0.33
57 0.36
58 0.33
59 0.33
60 0.28
61 0.29
62 0.3
63 0.24
64 0.23
65 0.22
66 0.27
67 0.24
68 0.31
69 0.37
70 0.44
71 0.42
72 0.49
73 0.53
74 0.5
75 0.49
76 0.42
77 0.38
78 0.29
79 0.28
80 0.25
81 0.18
82 0.17
83 0.19
84 0.21
85 0.19
86 0.2
87 0.29
88 0.33
89 0.33
90 0.33
91 0.31
92 0.31
93 0.32
94 0.31
95 0.22
96 0.2
97 0.17
98 0.16
99 0.15
100 0.13
101 0.13
102 0.14
103 0.14
104 0.09
105 0.1
106 0.1
107 0.1
108 0.1
109 0.14
110 0.13
111 0.13
112 0.13
113 0.11
114 0.11
115 0.14
116 0.15
117 0.11
118 0.1
119 0.11
120 0.12
121 0.14
122 0.14
123 0.11
124 0.1
125 0.1
126 0.1
127 0.09
128 0.08
129 0.06
130 0.07
131 0.08
132 0.07
133 0.07
134 0.07
135 0.07
136 0.08
137 0.13
138 0.19
139 0.24
140 0.27
141 0.31
142 0.32
143 0.33
144 0.35
145 0.29
146 0.27
147 0.28
148 0.29
149 0.28
150 0.3
151 0.29
152 0.29
153 0.3
154 0.3
155 0.29
156 0.3
157 0.33
158 0.4
159 0.4
160 0.47
161 0.49
162 0.5
163 0.46
164 0.46
165 0.48
166 0.44
167 0.5
168 0.52
169 0.52
170 0.53
171 0.58
172 0.61
173 0.6
174 0.66
175 0.69
176 0.7
177 0.74
178 0.79
179 0.83
180 0.83
181 0.83
182 0.77
183 0.73
184 0.7
185 0.68
186 0.65
187 0.64
188 0.62